SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig37469-snap_masked-ConsensusfromContig37469-abinit-gene-0.1-mRNA-1:cds:7150/16281- from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ConsensusfromContig37469-snap_masked-ConsensusfromContig37469-abinit-gene-0.1-mRNA-1:cds:7150/16281-
Domain Number 1 Region: 258-331
Classification Level Classification E-value
Superfamily E set domains 0.000000242
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Weak hits

Sequence:  ConsensusfromContig37469-snap_masked-ConsensusfromContig37469-abinit-gene-0.1-mRNA-1:cds:7150/16281-
Domain Number - Region: 357-448
Classification Level Classification E-value
Superfamily E set domains 0.0166
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.037
Further Details:      
 
Domain Number - Region: 160-193
Classification Level Classification E-value
Superfamily PKD domain 0.0562
Family PKD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig37469-snap_masked-ConsensusfromContig37469-abinit-gene-0.1-mRNA-1:cds:7150/16281-
Sequence length 819
Sequence
MELQGLHLAAPALSVGKDELCNISVQYSAGAPPTVVRWWTPDYRHDLDDKLSVRVSFTSP
GETRVRVLVANEFGNDTAETFVLLEFGVGESVRLWYEVDADRPASAVWMVGLSDDIWAGI
PNQWRTTHNFNSSRNETKPQSAPMNPNSTVPTSLGLPAHSPSTPISWWFTAPGEYAIFLR
TYNDDGFANTSVTGVCNGTGECLGCDLVPNSNLRMDACNVCGGDNSACIGCDKIPNSGLE
YDACDVCGGDSSTCVPAVRSVFPVAGPIRGGTSLTLLADNVVTASDLTCLVDGLEVAAQL
LRRSPDGDIVLCHSPPSTCAADVCDVSVHVRFTIARANSLQAHFMQSVEGATFTYFLHPA
AGSAAGGLALTLTGLNMSLAGFSSSGVSAFHVVGRVRICDRTVSTQELLHGRAIVRIPAK
EARQPSNCTVSFSFADGIASSNPLFFYYYGADLETLVKLASGGVAIATNTLTLNASRDEG
CNGTLFSVPASSVPRGNAVVQFSPNGQDWTTRKRLVDSSAAVLVRGTRPGPGCGSLESIT
VIVDRSSNRSSIMSFAPSSALSSPGIAPVRLASSLRQTYGINETVFVGEIYYYGTSMTTN
VSSCRLSGGSQLWFEMDPLLSDGVHKAGLNVSEMKCAFLGLAGAIVAAFPVARVDGRTIR
CSASPDARHVLPVYVEGSASASVPVRVAVSLNGIDFIEVMNVSLSLWDPYVSDLLTDTMD
LWTSDLDSASAVPTLLQRTMEFEGRVFVDSRAASTTCSLMANVNGGPRYINGTVACKDNC
TRYECTLRVPKDTVPGMYAVFIGVAGQGFPTGYQVAVLS
Download sequence
Identical sequences ConsensusfromContig37469-snap_masked-ConsensusfromContig37469-abinit-gene-0.1-mRNA-1:cds:7150/16281-

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]