SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig37811-snap_masked-ConsensusfromContig37811-abinit-gene-0.0-mRNA-1:cds:7738/422-53 from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ConsensusfromContig37811-snap_masked-ConsensusfromContig37811-abinit-gene-0.0-mRNA-1:cds:7738/422-53
Domain Number 1 Region: 420-502
Classification Level Classification E-value
Superfamily E set domains 0.0000467
Family Filamin repeat (rod domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ConsensusfromContig37811-snap_masked-ConsensusfromContig37811-abinit-gene-0.0-mRNA-1:cds:7738/422-53
Domain Number - Region: 864-957
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000863
Family Invasin/intimin cell-adhesion fragments 0.0041
Further Details:      
 
Domain Number - Region: 247-313
Classification Level Classification E-value
Superfamily E set domains 0.0331
Family Filamin repeat (rod domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig37811-snap_masked-ConsensusfromContig37811-abinit-gene-0.0-mRNA-1:cds:7738/422-53
Sequence length 968
Sequence
MELQVLPAALRKAVPILPPLNTLVAGTEFRIPLRCEDSGLKCPQFGNTVLDVEGLRATLL
GPVERADLVVESSDGGLVASGRVTAAASYRLCLHACGEAVEVPFVISPGPPHVPATRISL
AARALVAGDPVSAAVELFDKFGNPVPIDAGAVTGVACIGGAEVPIRAADRNSRLGMNSLT
LSLPSVERAGEWNLRVSVDGEPVPADLVFTVHPCPAHAASSKCSIEPALVSREGTIDLRV
TAIDRADAMGSYGNERRQGGDAVALLFEPSDGLSSSVVDNSDGSYSITVTGMRGSVDLSV
FINDELVGGGPLQLDGGSGLVAWAAAELQSDSERIPAGSEAHGRLLCFDAYGAAISYSDR
VQVECQPECPVSISAHGEFSFRPTRACRHTLRALLDGKPTAGPTASVEVTPASGTPSLSA
MRIRPAGKGRVEAGTCCSILVISTDRFGNALTAGGLRLGVRASRPGAADAVEFDIADMQD
GRYEATARLEASGTYGVLCELEGAATAANLSLDVIAGSVARCEFAEGGSPRARVRAGEPV
EVALVGYDRHGNACRGFAGQLAVSLGGHPLAPAADRGDGAVARFALEALLVATRLQPDAP
LLEMPVEAGLPALARLALRDRFGNACDPSGVEAVVRAVDAAGEELEAGTGLLRAVFERAG
RGAISATLGGEAVGAPVELDVLPGPASAASSRVESLPVEWRAGRPASFRLLVSDRFGNSS
PTVASAAVVAAWVECGAPSGRVEAHALLDGCSHVLTADVKRAGAARLHVTLGGEPPGGAS
SVLARVPPRVLAGAPLRLELRPVDEHMNAASEELLFSLAPGAGGPVVPVPREGPCRLVEA
GRYRLRARRADGSEGALECEVCAGPPALERATLTGLPASLSAGEAAPVAARLFDAHGNAC
TELAAVAVAVSGPSGRTTVALRPASEQGAYEGSLELTAAGSYTATLTVGGAAASARPHAF
RVLPGPLA
Download sequence
Identical sequences ConsensusfromContig37811-snap_masked-ConsensusfromContig37811-abinit-gene-0.0-mRNA-1:cds:7738/422-53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]