SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig6642-snap_masked-ConsensusfromContig6642-abinit-gene-0.1-mRNA-1:cds:63/2101-2170: from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ConsensusfromContig6642-snap_masked-ConsensusfromContig6642-abinit-gene-0.1-mRNA-1:cds:63/2101-2170:
Domain Number 1 Region: 693-817
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.42e-20
Family Histidine kinase 0.01
Further Details:      
 
Domain Number 2 Region: 74-239
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000053
Family GAF domain 0.012
Further Details:      
 
Weak hits

Sequence:  ConsensusfromContig6642-snap_masked-ConsensusfromContig6642-abinit-gene-0.1-mRNA-1:cds:63/2101-2170:
Domain Number - Region: 627-692
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000196
Family Homodimeric domain of signal transducing histidine kinase 0.0073
Further Details:      
 
Domain Number - Region: 490-624
Classification Level Classification E-value
Superfamily GAF domain-like 0.0236
Family GAF domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig6642-snap_masked-ConsensusfromContig6642-abinit-gene-0.1-mRNA-1:cds:63/2101-2170:
Sequence length 859
Sequence
MAKIHRELKVRSGMLRATEWGGMVTGCLVVAWGGDHEVSQHDVALFESICDQENLMRDLH
AKNRELEAQRAVLERQLQSEALHRSVARSIRTTLDLREILRDCAGRIRALFDAESVMVNA
FRVGGDRSAAEKIGTADELQAALATRGKACFERDWSRLVPEIDRVVNPNLSEDSVSDIAR
IEDFRLLRESVRSMGFTSSLFMATEWNDQVTGFLAVGWDAVRDTTPHEVALFEAVCDQAR
VPPRRGTESIKALKRVDARSQIGHAIGQENLLKHLEAKKKELEDELFDADSIMGRCKPAD
VIGTKDELQARIWSPAAKHRIVRMLARPGVVRFERDWMRFVEDVDGGGPARDENDEAFKR
MQNEIQALGFSSCIMQGTEWKGQVTGLVAMGWSRARDPSPHERGLFSAVCDLLGHSARCD
FALQFHIGLNSLLTDLEDKNRRLEEELARAKLLSISAEIRNTLDPRKCKQSTPQPRASAW
IPPILSYFGRIVESTVHRLREALGAGSSFIMTLEPEANCKGTMRVVQLATSMREDLELAA
TASNPTHETLDPLHGRVQSWADETPGPDGLASAPVVALLDSMKIRAGLFSPTGEGDVNGI
VSVHWEEPGRPVTPGDVALFDDVCQAELVQQARAAAKAKSDFLSILGIVGLLLDDSRLFS
EQREYLQVAQSSGQALVELVSEVLDASALERGGRLRVAPEPMCLRACIEDVMEVLWPVTG
QKNIAMQFIIRRSLQRCIVSDPARIRQVLINLVGSGCGIAEADQRRLFEFFTQLDNTKSR
RHPTGLGLFISRGIARALGGDMQLVSTPCGSTFAFLFRAAPLATGAMKAGPDVDPALRGR
TLIAAFDEEVRYKIRNKQG
Download sequence
Identical sequences ConsensusfromContig6642-snap_masked-ConsensusfromContig6642-abinit-gene-0.1-mRNA-1:cds:63/2101-2170:

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]