SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig6644-snap_masked-ConsensusfromContig6644-abinit-gene-0.0-mRNA-1:cds:96/1850-1935: from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ConsensusfromContig6644-snap_masked-ConsensusfromContig6644-abinit-gene-0.0-mRNA-1:cds:96/1850-1935:
Domain Number 1 Region: 2060-2138
Classification Level Classification E-value
Superfamily E set domains 0.0000000077
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Weak hits

Sequence:  ConsensusfromContig6644-snap_masked-ConsensusfromContig6644-abinit-gene-0.0-mRNA-1:cds:96/1850-1935:
Domain Number - Region: 2145-2293
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0185
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig6644-snap_masked-ConsensusfromContig6644-abinit-gene-0.0-mRNA-1:cds:96/1850-1935:
Sequence length 3569
Sequence
MENRTNVRAWAALHSAESGETVVNWTSVAATYSAAAGVAAATWTVPTWLNTSVAGYRLRV
SRYAVDLLGPDPSVWAESAEFVVRYRLFAGDAIVDNIASGVRVKWRLYGVLLEPLLIWLR
YTNASSSSDLGLVSDSAVASLEFIDWPVALTAGLLPYGAGQLEFVVSIPNTTASDVVLPV
SQLYPIVQNVSISNGYTDTHVLHGSSIVIRWEHLFAAGDPTAALNESATFDVRLYKYPAE
APLVELLNISTSAPRSARLGLSWVVPVSVPRGQYFIRVSQIVAGAVSPAIFRDSAAFDVI
AVLSMTVLGRNSTQVASMHVFGVVAISWSWLGIIPSPGTLQLELWTANATGLIQRLVTIA
TGLGNTTKSFAWTPSSAVLPLPGPTSTTAMAAFYSPASLRLVLSATSDSLTVTINRLTLQ
PVISSVSLSGLYQDSLAYTNLNVTARFTLALVDRNASAVVAVIASNVAASTPNATSTARY
VPFGFATDFYSVRVSLYNASAQASSDAIIFANSSSFFIQGVILVSILRPQPNTSFNIFNP
ITVEWRVLGRLRGSKLVNVTARAALPGGPLGPEVPVGPAGSALIGDGVQRVAWRPGSRIL
PAPLSRPPPAPYNVTVTVVSLDELSLRGSANGTLGPWAETVRSAPRVIGRVTFLVENDSW
AVSWRWSSNDSYADESLPSSLRWNIDAVPRPAPGGDAANATTRRLASGIAATYADGVYSY
TGGMYVLRILRVEEDTQDVQIWADTTEYEIRDGYVITVPQSCVNIAQTIPLSWLVVGNPG
GTVDLLLRNWSAPATSDDGVILFATSISATAGAGSYQWAPNRTRLLELVRAVPPRSAVDV
FGAEGSIIVRSTSAPDLHFMEAAICLRSYISIPYTGVGMAVNYGGVAFLNSSRTAYWNSS
DPEQSDGLGSRTRPVNAYLRFQGQGQQPVLLASNKSSPFNFTIPAGLLEGSYRLRFYLTG
SDLSDDANVFADGLPFTLNTGAEVDPLPSTADHIYDEWRAAGVTNLAVLSFRSYRLSTVA
VELWNISGGGDPVLDPLSALYRHSLGAKVADIARGVRVQSGDNALSFVPSLPPARALVVP
SPRSASDLYVTSPAYIVVRSEDDPSVVSYNYAHLAPFIRSVVIDAPSGLQAGSAITIRWT
LAMRGALGLPVNASFSVSLMRSGRVYTTVASDVMTVVSGNRDYNLTTPFSIPANYPSDSY
TILVSLLNSTGAADPAVYASSSPISITLPAYTGNGPLGPDTSSQIACAASGLLVNASSTM
ACTFHPRRVGAPSSPAMTADEFFLSVSLTGGTLLSGFARGLATQFGFAIAAGPQTGVFAI
QVVNTSGSVVASKPYAIYDVPDASSSIACSPTVIRRSEKQNCSIAFRLASKLVLPAGNGE
LSVNTTVYEEPDATSYFVVNATAFTFATVNATSYMVIGRGNAFNATVVPQSKGEGILANC
SALEVTPSHFVDLEANPTIELGDRSFVTLSNISRGDDPLGLCNSFTVTIFYLAVTATASI
NDFQPDPIIVNPSNIALIARFTTVAGPSISRLFSITITTGEVASADTKPAEVAIKLKSDK
SLRFNTSASPSLKQEISVVGFGDSTSKLLCASRYVIANRDIGCTFSPRLRGEPVVAPPTN
LLRPQTSGALGNATGYLLATNDPVSDFPFRVTGGPSAGMGRAIVSMVVRGGTLDTVAEVQ
VVSEPDGTSLGVCPPPDAPVFRRTPFEIELLPRYKDASIPTVPAFLGPTFGGAPLATGEI
VAPSGVELPASKLLGESIHALPSAFTSLQVSAPERVAIAAGGEAVESLDLSLISSAPSKE
FAFRAVLPGTSGPCTISAPLAGDSGVNATAVQFVVYAYLDPDAANVTCAFGAFAAVNKSL
ACKARPEKAGSGVWSRHGSLRVAVNFGNPASVDGRRLLGAATSVITLAPGVSNAFDFQLD
FRTRPQSQHASSSKPGTYIVMGRAFNEVSGEERNCTILVEQAVSGLRLATCGQRSAVAYK
TPCNLTAFVEAGSNVRFRYRILRSESQSSEQTFDSAVAPWEAALPGKYAVAVRAYNSRYQ
LDDPETPEALVLVDVVPPRILSAFPSRSPAIGGVDVDIVGEFFSSDRGLQCFFGIANVPV
LADVFSSTRARCRTPPTEPTEPFTIPLVLGYDGVTFLEGAYNNFTIEGCPPGYYAITYDV
PCNPCSQGSFSAGGRAPQCLCPADFYQPFIGRPDCIDCPANAGTNRVEGVAMLSYCMCNP
GFYGFAFNGRPCDACPREGSRCNRYNMTLPEAASGYFISSANPTIAYSCEPPEACPGGID
SCTEGYACLRSDAVVYYRLGAFCYRCPGISASFVILCIILFFALFVIGVLFASVSQRRIN
DIGQLVRVSINMVQTIINALSVFNLNIEWLRPECSRGNSFLIKWLVTLTLPLALTLFGIF
VWVLAVAWSPLGRKFQMFLKRQQAASERRTLQTDNDDRMSTSGYSDRSSRLDRSSIADDS
ESADGDRLADHMDVDAYGAPAETQETKKHRSASTVVLLWWEVKHALAPSTIKRGGQRAWT
SMARAGRSFLAQLQRLALWLFTYSLHKESTDALAPEALAKTRRMRKRLRLQRMYEEVDLE
EDDERKRRNRTAKELAILYVHALLLGASMAYVLLGQYALSTFACIPNTDGRFYLASEPSI
ECDKDGTWGKMLGAGIVGVLLYTIGIPVVLLSLAFYGLKTNKVRDQQFKDVCGFLVLQYR
PKYPWEVVILMRKLAIIINNLFLVNRPVLQSIIAFVILFAATLVQISVKPYTIPRINRLE
SLSLMCTMFVLFGGLVFLNADVTDEVIIVVQILLLALLAVFGLMIVYITLNTLRYGRARK
ARRKLQMRLLLISTCHQVIPVAALQIGDFQLDSKTIEKIDDWFDGLQRRVRKGHAGAERQ
RNLLYMYCARTARKARIYIAGKAESGYLFNDDVSFVAHRILMERGRLYVPPSDECAVTRE
VDVRKIKALLDNMREFMRLQHAVTRQLGGAAYSAGHRVKKAPKLRWIASGYLPTPSQLVT
SAHARQDSYGSGLQLPPLIATLLSPFYRLKKWMGARVTQRVWDDPLEDRVAEAVALELRE
LEEDRLLGIDGLEEILKADVDTSGAVDVEVEYGAVDDFAELATTNAGSAAVTVLGRLAGL
LDELAEFPEDFAVHPALVHMIVRSLRVLQKPLSVAAERLEKSAKAKSEAIKSGKNTSIVS
IQRANSEAKTAKRAKRVLQKLKRRAANLKRFDAAEASDSDDSAFDADDVREEAVFAIDDP
DLEGPASKKEDEDDELDSKSRASSSKADGGDTPAPVACGQTYATFIKHARKREKALRESR
VVRTSRADSRGDGSEAWAASRNDETIRLPFVYEKDYIELTDDAPREGDEAARIELRNCTN
ELKLLSSILPEGGTVPDAMLPTDAARLSDALKLFRGIPVVTLQQNKRTACEAARALALLC
HGLAAYDQEKDGGVALNLYRQTVPIYEEVCYELGPLMDLLAISEREGRRKLVASILSTLT
NIVAVSPSERARSRHLHAVLPRLLGVIASIPPAFAAERASTRAMRAKLELLASIIDNEVA
PWELRDALEDAIWDMARLELVGICLDRPL
Download sequence
Identical sequences ConsensusfromContig6644-snap_masked-ConsensusfromContig6644-abinit-gene-0.0-mRNA-1:cds:96/1850-1935:

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]