SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig9528-snap_masked-ConsensusfromContig9528-abinit-gene-0.0-mRNA-1:cds:2846/90-364:0 from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ConsensusfromContig9528-snap_masked-ConsensusfromContig9528-abinit-gene-0.0-mRNA-1:cds:2846/90-364:0
Domain Number 1 Region: 1584-1643
Classification Level Classification E-value
Superfamily E set domains 0.0000171
Family E-set domains of sugar-utilizing enzymes 0.021
Further Details:      
 
Weak hits

Sequence:  ConsensusfromContig9528-snap_masked-ConsensusfromContig9528-abinit-gene-0.0-mRNA-1:cds:2846/90-364:0
Domain Number - Region: 1749-1805
Classification Level Classification E-value
Superfamily PKD domain 0.00126
Family PKD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig9528-snap_masked-ConsensusfromContig9528-abinit-gene-0.0-mRNA-1:cds:2846/90-364:0
Sequence length 2391
Sequence
MGTDVTLRATVAATLRSATVYPNVAGLRLAVSGSLVLATLSDVDQTAPALPSVTVTLATS
PDLCMTCTGPGAFTIWNAAGQLLYSLPVHVYTPGAAVLSCPNTPIPAQAFNCTATFYDVL
DGTELYANLDDVAATAAGGSASIVPPSNGPVQSRITITVHPTTDPPPGFNGNVAVQAVLK
NGQLLGTALVPIIYVADNSSSVACAKPQVALAGTIECTLTPRRLGELVWTDAATIGFEGD
GALASVAGTLSPTSGPAQSVSFRVIGQSGRLLTGPSLAMALSYGVSIANATIIVFASPDA
TSSAMCPGRVWAGESAVCTFYARKNSLVIWANLADISSTGVASVKGASLMSGYAVEGQFD
IYTTSNPSSDHSGPGRVDLSSSSNIFLGSGSITVLVPSYDGSSLACPATPMVALVPFNCT
YYPKRVGFSIYGVPENVSLNATNARAAIAEAAGTFGPSFIVAVVADRDPVVGGESSVEIF
AWLSGTEERLGEAKALVSYVVDASSSLECGAEQLALASTVDCTLTPRRLGELVWAEASTI
GFTGDGALAPVANSTAMTLSNGESASNTTVLVYGPPDSTSTITCDNPAAMWAGSISDCIF
IPRMQSAVIWSYLNDVTFSVSGSIKGFVRTAMEGYQTEGKFTVVTTNIPDATYTGPIDFA
TSVTLASYSFVVINPDSALATSVLDCPLGHQTALVSFNCTFYPKTGDVAVFGIASSVTAY
SVNSSTFVADPPSTVATQFTVTVTAAASPISEGGSSIVIVAYLLSLNGSSTGMALARSTV
PIVYIADESSSLACGVAQLILMAVVDCTLTPRRLGELVWADAATIGFIGDGALSPSFVFQ
MRAERGRLLTGPSVAMALSAGLSVANASVLVYGAPDNTTTATCDQNIWAGVSAVCSFTPR
LDSEVIWALLDELVPVPFASVKASTFMTGYATEGNITFDTTAVPMSDHTGPGGVEFWSSS
GQLLTAGHTIVQVPEDMNDGCSLVCPSTQQTALVPFNCTFVPRRAGFVIYGLSDNVTANA
TNADAVVFEPFGTLATQFTITVTAWATPVTNGSSAIRVLAWLPGMETQLVEAGSAIVYIA
DESSSLACGAEQLILTAAVDCTLTPRRLGELVWADAATIGFIGDGALSPSFVFRMLGESG
RLLTGPSKPIVLSSGAPVANAFSASLTDYIPMLGYATSGRLFVNTTAEPSEVFTGPGRVQ
VVLQADPVIDLASASISVMIPRSSADNSTLSCPSYQLPALIPFNCTFIPRRAGFVIYGLS
DNVTANATNADAVVFEPFGTLATQFTITVTAWATPVTNGSSAIRMLAWLPGMETQLAEAG
SAIVYIADESSSLACGVAQLILTAVVDCTLTPRRLGELVWADAATIGFIGDGALSPVAGS
LQPGAGPAQSFVFQMLGESGRLLTGPSMAMALSSNASIVNSSITVYRDPDATSSLICPSE
PVWASNRTTCTLIPRWRITVLMEDLFVSWGGSVLQVDAPSGVSPEPLAVVTIVFPQINCT
FSPAQTGIPLMASLANMSVVVRGMPGSAAWMPDSPAIGDLFLISHVAPMITTGGYMLAVY
STGFNGTVFEDAASAELYVTNSVIGEAYPDVGPMTGGTRVTLTGTALPPNTGAKLEARVC
NSPAVVWSLTATQAVIVTPPAFSSEAVNETGTSANATSAAGQPSNSTASSSNSSTLAPVG
LAYCDIDLSVGGVLAGIWPSSFYNAPPVAHISPLPARIALPIASLELSAFLSFPDIVAQR
GAPAPSEGLFFAWSVVGPGPAHFGNDSLANVTVANLTAPGNYTFTVDVTDADGGELASAS
VTVEIILLPLVTTVRADMSFDAFQLKYANASYKAALRSSLAKAYGVVEGRIAGISAKAGS
VILSVNVTASSLAEAEMLPQVAQAFTVPAAGVAQINSSILDRGENAPPMPILVGPKDIEV
NGSAFWTLDGRQSSDVDGAVQSYVWNLIPDPGCPLTADLDTSVPGFCNVTTKEQGFCQIE
FNVEDSDLTTSTEPIIINLVMNPRQNLPPVIFGTRKVKARIGARLASTSLKLEPRIADQD
EDFIASVRWEQVFGPGNATLKSSGQTAVEISGLTAGKWRFRVTATDNGVMGVLRPLSSKA
DFDVESSTSVVDSVDPATAKAAGETIATAVAASVAASVAIAVAGSVMGAVPPALPARLAR
LGPLAVQRGDAPNPKVEGDTNTGTTTLINQTQKIAVIGGIAGENVPESYRAMSGALGTFM
LQFNVVPLDGSGNGTSAAPTPTPVPRPAARKMLQAVATAATMSASEMARKAFQSAMLYGF
GILAIVSLFHLLLHLVVVRWLKKLPGLPGKLFPFPELSVLMSVYQPMAMASAAYLPLAPA
GVQAGIIIFLILGCVVVPALFLCVLVYRIRNDRLLIYEPNEPIFQVQPFPR
Download sequence
Identical sequences ConsensusfromContig9528-snap_masked-ConsensusfromContig9528-abinit-gene-0.0-mRNA-1:cds:2846/90-364:0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]