SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig9710-snap_masked-ConsensusfromContig9710-abinit-gene-0.0-mRNA-1:cds:2687/852-890: from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ConsensusfromContig9710-snap_masked-ConsensusfromContig9710-abinit-gene-0.0-mRNA-1:cds:2687/852-890:
Domain Number 1 Region: 72-138,217-243
Classification Level Classification E-value
Superfamily E set domains 0.0000265
Family Filamin repeat (rod domain) 0.034
Further Details:      
 
Weak hits

Sequence:  ConsensusfromContig9710-snap_masked-ConsensusfromContig9710-abinit-gene-0.0-mRNA-1:cds:2687/852-890:
Domain Number - Region: 162-244
Classification Level Classification E-value
Superfamily E set domains 0.026
Family Filamin repeat (rod domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig9710-snap_masked-ConsensusfromContig9710-abinit-gene-0.0-mRNA-1:cds:2687/852-890:
Sequence length 275
Sequence
MFVAGQSLELFIRMMDGYDNVYDAGERPEGVQVTASIVPDGRDVRPDVQWADEAHDSPVA
CFVYAAIFDRNCTVELVDGVSVKTAEAFEVLVSLRDRYGNSRAGWRDPLTVYVTGSLVVG
NEIEIVDEDTGVQRISFFTERSGLTPLTGTGLELVCSFKGTSIVAGAQVELSVICRDTRS
ETDDRPLLEFACWRNDDPFQFPPFKPIGNGEYKGDPPKRAGKYILSVATAGAELPGSPAR
WEVLTGAISSKELVLRSGGTTDHRIPLVDPFGNAL
Download sequence
Identical sequences ConsensusfromContig9710-snap_masked-ConsensusfromContig9710-abinit-gene-0.0-mRNA-1:cds:2687/852-890:

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]