SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|560148372|ref|YP_008841167.1| from Brucella ceti TE10759-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|560148372|ref|YP_008841167.1|
Domain Number 1 Region: 7-340
Classification Level Classification E-value
Superfamily SIS domain 1.24e-65
Family double-SIS domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|560148372|ref|YP_008841167.1|
Sequence length 343
Comment sugar isomerase [Brucella ceti TE10759-12]
Sequence
MNSPSSLMLQETEQSPAVVAKLLEKEAGTFAEIARIFRKNDPAVITTAARGSSDHAATFF
KYLIEIATGVPVASIGPSIASVYGSRLKLKNGLHFTVSQSGASPDIIAAQEAAKKGGATT
IAVVNVVESPLARDADIVLALHAGEEKSVAATKSFIASVAALSGVVAASSGDAGLRGGLE
RLPEALAATRPEGREVVENLLFNARSLYTGGRGTAFAISLEAALKAKETANIHAEAFSLA
ELMHGPMRLIEEGFPIVSFLPRDEAFDTNIAALKRLHSFGASIVTLSDAQTPGFRLPSAS
TGSPHLDPLVSLINYYRVIEAVTRRKGFDPDKPRNLNKVTVTV
Download sequence
Identical sequences A0A0E1WV93 A0A0H3ARV3 A0A0H3GBZ2 A0A0M1WH84 A0A2D2BUP1 A0A2K4NNT7 A9MCJ2 C7LJ32 D0RF86 D7H6D2 N8LQH0 Q2YJ13 Q579D1
gi|161620964|ref|YP_001594850.1| gi|83269242|ref|YP_418533.1| gi|376270878|ref|YP_005113923.1| gi|23500639|ref|NP_700079.1| WP_002965735.1.100018 WP_002965735.1.100443 WP_002965735.1.101150 WP_002965735.1.101965 WP_002965735.1.102082 WP_002965735.1.10307 WP_002965735.1.10322 WP_002965735.1.10630 WP_002965735.1.10893 WP_002965735.1.11620 WP_002965735.1.12041 WP_002965735.1.12241 WP_002965735.1.13020 WP_002965735.1.13460 WP_002965735.1.13592 WP_002965735.1.13826 WP_002965735.1.14507 WP_002965735.1.14542 WP_002965735.1.14633 WP_002965735.1.15077 WP_002965735.1.15325 WP_002965735.1.16733 WP_002965735.1.16975 WP_002965735.1.17378 WP_002965735.1.1800 WP_002965735.1.18034 WP_002965735.1.18635 WP_002965735.1.19641 WP_002965735.1.19645 WP_002965735.1.20012 WP_002965735.1.20317 WP_002965735.1.20827 WP_002965735.1.22340 WP_002965735.1.22583 WP_002965735.1.2337 WP_002965735.1.24196 WP_002965735.1.24428 WP_002965735.1.24655 WP_002965735.1.24726 WP_002965735.1.2483 WP_002965735.1.25101 WP_002965735.1.25382 WP_002965735.1.25561 WP_002965735.1.25729 WP_002965735.1.26599 WP_002965735.1.27052 WP_002965735.1.2778 WP_002965735.1.2839 WP_002965735.1.2874 WP_002965735.1.2877 WP_002965735.1.28889 WP_002965735.1.31106 WP_002965735.1.31239 WP_002965735.1.31463 WP_002965735.1.32337 WP_002965735.1.32492 WP_002965735.1.32731 WP_002965735.1.33220 WP_002965735.1.33599 WP_002965735.1.33753 WP_002965735.1.3390 WP_002965735.1.33907 WP_002965735.1.34225 WP_002965735.1.34353 WP_002965735.1.35056 WP_002965735.1.35970 WP_002965735.1.3681 WP_002965735.1.37797 WP_002965735.1.38343 WP_002965735.1.38353 WP_002965735.1.38790 WP_002965735.1.38925 WP_002965735.1.39021 WP_002965735.1.39039 WP_002965735.1.39963 WP_002965735.1.40138 WP_002965735.1.40407 WP_002965735.1.40624 WP_002965735.1.40649 WP_002965735.1.408 WP_002965735.1.40871 WP_002965735.1.41044 WP_002965735.1.41311 WP_002965735.1.41835 WP_002965735.1.41893 WP_002965735.1.41941 WP_002965735.1.41950 WP_002965735.1.42071 WP_002965735.1.42103 WP_002965735.1.42427 WP_002965735.1.43006 WP_002965735.1.43359 WP_002965735.1.43583 WP_002965735.1.43597 WP_002965735.1.43689 WP_002965735.1.43928 WP_002965735.1.4428 WP_002965735.1.44294 WP_002965735.1.44793 WP_002965735.1.44989 WP_002965735.1.45559 WP_002965735.1.46182 WP_002965735.1.46432 WP_002965735.1.4727 WP_002965735.1.47558 WP_002965735.1.47610 WP_002965735.1.4847 WP_002965735.1.48744 WP_002965735.1.48948 WP_002965735.1.49542 WP_002965735.1.49640 WP_002965735.1.49753 WP_002965735.1.49942 WP_002965735.1.49953 WP_002965735.1.50051 WP_002965735.1.50053 WP_002965735.1.50282 WP_002965735.1.5052 WP_002965735.1.52027 WP_002965735.1.5236 WP_002965735.1.5307 WP_002965735.1.53128 WP_002965735.1.53481 WP_002965735.1.53843 WP_002965735.1.5394 WP_002965735.1.54440 WP_002965735.1.54779 WP_002965735.1.55440 WP_002965735.1.55684 WP_002965735.1.56313 WP_002965735.1.56334 WP_002965735.1.56683 WP_002965735.1.56947 WP_002965735.1.56952 WP_002965735.1.57564 WP_002965735.1.57925 WP_002965735.1.58260 WP_002965735.1.58525 WP_002965735.1.58539 WP_002965735.1.58868 WP_002965735.1.59086 WP_002965735.1.59091 WP_002965735.1.59515 WP_002965735.1.5971 WP_002965735.1.59985 WP_002965735.1.60631 WP_002965735.1.61325 WP_002965735.1.61536 WP_002965735.1.61811 WP_002965735.1.61997 WP_002965735.1.62592 WP_002965735.1.63732 WP_002965735.1.64124 WP_002965735.1.64849 WP_002965735.1.64853 WP_002965735.1.64905 WP_002965735.1.65131 WP_002965735.1.65299 WP_002965735.1.65454 WP_002965735.1.6555 WP_002965735.1.65625 WP_002965735.1.65651 WP_002965735.1.66260 WP_002965735.1.66810 WP_002965735.1.67893 WP_002965735.1.67996 WP_002965735.1.67997 WP_002965735.1.68488 WP_002965735.1.68913 WP_002965735.1.69451 WP_002965735.1.69829 WP_002965735.1.70296 WP_002965735.1.70322 WP_002965735.1.70570 WP_002965735.1.71002 WP_002965735.1.71194 WP_002965735.1.71689 WP_002965735.1.71846 WP_002965735.1.7206 WP_002965735.1.72439 WP_002965735.1.72916 WP_002965735.1.75458 WP_002965735.1.75766 WP_002965735.1.76350 WP_002965735.1.76433 WP_002965735.1.77321 WP_002965735.1.78109 WP_002965735.1.78716 WP_002965735.1.78821 WP_002965735.1.7984 WP_002965735.1.79963 WP_002965735.1.8012 WP_002965735.1.80266 WP_002965735.1.80365 WP_002965735.1.80476 WP_002965735.1.80697 WP_002965735.1.81558 WP_002965735.1.81617 WP_002965735.1.81822 WP_002965735.1.8223 WP_002965735.1.8224 WP_002965735.1.82565 WP_002965735.1.8278 WP_002965735.1.8307 WP_002965735.1.83513 WP_002965735.1.84540 WP_002965735.1.85322 WP_002965735.1.85721 WP_002965735.1.85769 WP_002965735.1.8657 WP_002965735.1.87222 WP_002965735.1.87522 WP_002965735.1.87603 WP_002965735.1.87867 WP_002965735.1.8788 WP_002965735.1.88404 WP_002965735.1.8878 WP_002965735.1.90027 WP_002965735.1.90689 WP_002965735.1.91123 WP_002965735.1.91338 WP_002965735.1.9163 WP_002965735.1.91958 WP_002965735.1.92518 WP_002965735.1.9303 WP_002965735.1.93230 WP_002965735.1.93367 WP_002965735.1.93454 WP_002965735.1.93795 WP_002965735.1.94126 WP_002965735.1.94513 WP_002965735.1.94555 WP_002965735.1.94648 WP_002965735.1.94775 WP_002965735.1.95148 WP_002965735.1.97511 WP_002965735.1.97741 WP_002965735.1.98076 WP_002965735.1.98362 WP_002965735.1.98455 WP_002965735.1.99221 WP_002965735.1.99373 WP_002965735.1.99421 gi|560148372|ref|YP_008841167.1| gi|376277582|ref|YP_005153643.1| gi|560150808|ref|YP_008843601.1| gi|256015673|ref|YP_003105682.1| gi|376278860|ref|YP_005108893.1| gi|23500639|ref|NP_700079.1| gi|62317261|ref|YP_223114.1| gi|148558308|ref|YP_001257836.1| 204722.BRA0912 262698.BruAb2_0321 359391.BAB2_0323 444178.BOV_A0855 483179.BCAN_B0931 568815.BMI_II906 gi|340792686|ref|YP_004758150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]