SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|560148374|ref|YP_008841169.1| from Brucella ceti TE10759-12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|560148374|ref|YP_008841169.1|
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily SIS domain 5.06e-28
Family mono-SIS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|560148374|ref|YP_008841169.1|
Sequence length 242
Comment putative protein containing SIS (Sugar ISomerase) phosphosugar binding domain protein [Brucella ceti TE10759-12]
Sequence
MTEITDRYFNDVIARLSGLRDRLAAQMEKAADLIAAAARADRRVYVFGTGHSHMMAEELH
YRAGGLAITVPILCGSIMLQDGAVASSHFERIEGAVRPILDRYGIRDGDVLVVVSNSGVN
AAPIEAARYAREKGAAIIALTSVAYSNTIARGRTQLLSLADVVLDNDAPSGDAVLEIAGS
ALKVGPVSTALGVTILNAVFADVAARLVGEGDAPIYLSANMPGSGDINRSLVERYRDRNP
HL
Download sequence
Identical sequences A0A0E1WV37 A0A1Z1ZSM8 A0A2D2BVJ3 A9MCJ0 C0RM54 C7LJ30 C9V4U8 D0RF84 Q8FVD4 Q8YCZ1
gi|256015671|ref|YP_003105680.1| 204722.BRA0910 224914.BMEII0386 483179.BCAN_B0929 546272.BMEA_B0892 568815.BMI_II904 gi|17988731|ref|NP_541364.1| gi|23500637|ref|NP_700077.1| gi|376278858|ref|YP_005108891.1| gi|384410513|ref|YP_005599133.1| WP_004682301.1.100018 WP_004682301.1.100628 WP_004682301.1.100807 WP_004682301.1.101411 WP_004682301.1.102026 WP_004682301.1.10307 WP_004682301.1.1055 WP_004682301.1.10844 WP_004682301.1.10866 WP_004682301.1.11066 WP_004682301.1.11859 WP_004682301.1.11933 WP_004682301.1.12704 WP_004682301.1.12925 WP_004682301.1.12981 WP_004682301.1.13020 WP_004682301.1.1327 WP_004682301.1.13592 WP_004682301.1.14323 WP_004682301.1.15325 WP_004682301.1.16733 WP_004682301.1.1800 WP_004682301.1.18494 WP_004682301.1.19182 WP_004682301.1.19483 WP_004682301.1.19645 WP_004682301.1.22142 WP_004682301.1.22340 WP_004682301.1.23391 WP_004682301.1.24607 WP_004682301.1.2483 WP_004682301.1.24895 WP_004682301.1.24923 WP_004682301.1.24971 WP_004682301.1.25135 WP_004682301.1.25450 WP_004682301.1.25561 WP_004682301.1.27052 WP_004682301.1.27794 WP_004682301.1.29765 WP_004682301.1.29997 WP_004682301.1.31463 WP_004682301.1.31635 WP_004682301.1.31644 WP_004682301.1.31680 WP_004682301.1.32779 WP_004682301.1.33032 WP_004682301.1.33289 WP_004682301.1.33466 WP_004682301.1.3390 WP_004682301.1.34183 WP_004682301.1.34225 WP_004682301.1.34423 WP_004682301.1.35338 WP_004682301.1.35577 WP_004682301.1.36149 WP_004682301.1.36712 WP_004682301.1.3681 WP_004682301.1.38343 WP_004682301.1.38790 WP_004682301.1.38925 WP_004682301.1.40138 WP_004682301.1.40189 WP_004682301.1.408 WP_004682301.1.4091 WP_004682301.1.41105 WP_004682301.1.41344 WP_004682301.1.41893 WP_004682301.1.41941 WP_004682301.1.41950 WP_004682301.1.42065 WP_004682301.1.4207 WP_004682301.1.42071 WP_004682301.1.42633 WP_004682301.1.42774 WP_004682301.1.4295 WP_004682301.1.43006 WP_004682301.1.43058 WP_004682301.1.43148 WP_004682301.1.4319 WP_004682301.1.43359 WP_004682301.1.43583 WP_004682301.1.43689 WP_004682301.1.43928 WP_004682301.1.44045 WP_004682301.1.44060 WP_004682301.1.44294 WP_004682301.1.44541 WP_004682301.1.44793 WP_004682301.1.44989 WP_004682301.1.47516 WP_004682301.1.47545 WP_004682301.1.48075 WP_004682301.1.48184 WP_004682301.1.48396 WP_004682301.1.48727 WP_004682301.1.48744 WP_004682301.1.49089 WP_004682301.1.49542 WP_004682301.1.49753 WP_004682301.1.49953 WP_004682301.1.50924 WP_004682301.1.50952 WP_004682301.1.51553 WP_004682301.1.52027 WP_004682301.1.52478 WP_004682301.1.52541 WP_004682301.1.5307 WP_004682301.1.54481 WP_004682301.1.55047 WP_004682301.1.55284 WP_004682301.1.55585 WP_004682301.1.5609 WP_004682301.1.56313 WP_004682301.1.56621 WP_004682301.1.56687 WP_004682301.1.57541 WP_004682301.1.57564 WP_004682301.1.58260 WP_004682301.1.58868 WP_004682301.1.59091 WP_004682301.1.5971 WP_004682301.1.59985 WP_004682301.1.60134 WP_004682301.1.60631 WP_004682301.1.60920 WP_004682301.1.61081 WP_004682301.1.61543 WP_004682301.1.61961 WP_004682301.1.62592 WP_004682301.1.62990 WP_004682301.1.62997 WP_004682301.1.63628 WP_004682301.1.63732 WP_004682301.1.6440 WP_004682301.1.64585 WP_004682301.1.64849 WP_004682301.1.65199 WP_004682301.1.65299 WP_004682301.1.65501 WP_004682301.1.65597 WP_004682301.1.65651 WP_004682301.1.66078 WP_004682301.1.66268 WP_004682301.1.66407 WP_004682301.1.66647 WP_004682301.1.66855 WP_004682301.1.67107 WP_004682301.1.67659 WP_004682301.1.68488 WP_004682301.1.6942 WP_004682301.1.69522 WP_004682301.1.69997 WP_004682301.1.70160 WP_004682301.1.70296 WP_004682301.1.70570 WP_004682301.1.70760 WP_004682301.1.71002 WP_004682301.1.71228 WP_004682301.1.72189 WP_004682301.1.72439 WP_004682301.1.73628 WP_004682301.1.73739 WP_004682301.1.7388 WP_004682301.1.74236 WP_004682301.1.75128 WP_004682301.1.75563 WP_004682301.1.75678 WP_004682301.1.7667 WP_004682301.1.76877 WP_004682301.1.77281 WP_004682301.1.77685 WP_004682301.1.78590 WP_004682301.1.78716 WP_004682301.1.79327 WP_004682301.1.79993 WP_004682301.1.80059 WP_004682301.1.8012 WP_004682301.1.80167 WP_004682301.1.80365 WP_004682301.1.81276 WP_004682301.1.81377 WP_004682301.1.81558 WP_004682301.1.81674 WP_004682301.1.82205 WP_004682301.1.8223 WP_004682301.1.82390 WP_004682301.1.82595 WP_004682301.1.82753 WP_004682301.1.82834 WP_004682301.1.82990 WP_004682301.1.83513 WP_004682301.1.84207 WP_004682301.1.84764 WP_004682301.1.85684 WP_004682301.1.85721 WP_004682301.1.85753 WP_004682301.1.86832 WP_004682301.1.86901 WP_004682301.1.88404 WP_004682301.1.88424 WP_004682301.1.88658 WP_004682301.1.88867 WP_004682301.1.89113 WP_004682301.1.90027 WP_004682301.1.9096 WP_004682301.1.91081 WP_004682301.1.91768 WP_004682301.1.91958 WP_004682301.1.92383 WP_004682301.1.9303 WP_004682301.1.93230 WP_004682301.1.93367 WP_004682301.1.95141 WP_004682301.1.95148 WP_004682301.1.95178 WP_004682301.1.95770 WP_004682301.1.96661 WP_004682301.1.96710 WP_004682301.1.97240 WP_004682301.1.97320 WP_004682301.1.97331 WP_004682301.1.97860 WP_004682301.1.98362 WP_004682301.1.98764 gi|340792684|ref|YP_004758148.1| gi|23500637|ref|NP_700077.1| gi|560150810|ref|YP_008843603.1| gi|161620962|ref|YP_001594848.1| gi|560148374|ref|YP_008841169.1| gi|225686669|ref|YP_002734641.1| gi|384213412|ref|YP_005602495.1| gi|376277584|ref|YP_005153645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]