SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470176234|ref|YP_007562278.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176234|ref|YP_007562278.1|
Domain Number 1 Region: 84-318
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000445
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.03
Further Details:      
 
Weak hits

Sequence:  gi|470176234|ref|YP_007562278.1|
Domain Number - Region: 268-477
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00811
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470176234|ref|YP_007562278.1|
Sequence length 493
Comment hypothetical protein YM304_00260 [Ilumatobacter coccineus YM16-304]
Sequence
MPDRRSPNPRSRDGLLPPVGARTPGLDDLDDDTIRAEDDGDWDDDEWYEPNYMVRRALAI
GGTIAAIAIIVFVVSKVIGGDDGGSGSASAASAEWNHVVVLTDDEIRIVDPSNGDVVDTY
DGDADLLDAQSVVTGNVLVTMTDAGRITQTDLSDGTSTRGRASTDQALRLSTTNPTIAIA
GTDGGGDVTLIDTNERTTLRVGDVAGLDDPLIFPMEVYVNPDGTHAAMSDARSFQSTVVD
IAEGTAELLAGQVVAIGDDRVVTAQRAGANTELEFYDLAGERLGSVDVPTPAASLLTSDG
NMLLVDASGAIRLANADGDVSELGALSDTEAPTATIEVEAGTTAFGGTRLLAITSRQVFV
LNDAGLQLGVADGDITSTPTRASRCVTVGSPRSTGTSVQLDLDNASVIVEIGGGIVSNTS
VDGCTAALIGGASPQIVHDGEIIEVDANSIVDIAPDGEAYVVLDGRDSELLTIDGESNVE
VADVASVIRFAQR
Download sequence
Identical sequences M5AFL1
WP_015439588.1.75388 gi|470176234|ref|YP_007562278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]