SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470176317|ref|YP_007562361.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176317|ref|YP_007562361.1|
Domain Number 1 Region: 6-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000273
Family Thioltransferase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470176317|ref|YP_007562361.1|
Sequence length 217
Comment hypothetical protein YM304_01090 [Ilumatobacter coccineus YM16-304]
Sequence
MSDTTTEIEFWIDPACPFCWATARWVVDEVVPHRDISVTWRSISLLFKNDPPEGSEYRTA
AEQTHGHLRVMEAMRAAAESPEQGNHDVFKLYWELGARLHHDGNRDFEVAEALEAVGLDT
SFASAATDEQWDPAIQAAMDDGLGLVGNDVGTPIIAMKNSRGERVGYFGPVITKVPTGDD
SLKMWDALVAMMDVDGFFELKKTRTEGPNPGARPDPV
Download sequence
Identical sequences M4ZUQ4
WP_015439671.1.75388 gi|470176317|ref|YP_007562361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]