SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470176571|ref|YP_007562615.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176571|ref|YP_007562615.1|
Domain Number 1 Region: 212-513
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.92e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000122
Further Details:      
 
Domain Number 2 Region: 106-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.75e-23
Family PDI-like 0.0000943
Further Details:      
 
Domain Number 3 Region: 2-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-20
Family PDI-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470176571|ref|YP_007562615.1|
Sequence length 526
Comment alkyl hydroperoxide reductase subunit F [Ilumatobacter coccineus YM16-304]
Sequence
MILDAQLTEALRAHLPKIVQPIELVASLDDSATSTKITELLGELDVLSSDINTRTDGDDE
RRPSFRITRVDDPAVSVTFGGVPLGHEFTSLVLALLQVGGHPSTADPELLDQIRNIEGTH
RFETFFSQSCQNCPDVVQALNLMSILNPNIEHVAIDGAAFQDEVEAREVMAVPTVFRNGE
SFGQGRMTLEELVAMLDSGSADRAVEKINELDPFDVLIVGGGPAGSSAAVYAARKGLRTG
VVAERFGGQLLDTMGIENLISNPYTEGPKLAAELESNVRDHDVEVITAQRAERLEAADSA
GGLHTIALESGAALQSRSIILATGARWRKIDVPGEAEYANRGVAYCPHCDGPLYKGKRTA
VIGGGNSGVEAAIDLAGIVDHVTLIEFDHQLRADEVLQAKLRSLPNVTIITSAMTTEVVG
DGKKVTSLVYRDRNDDSEHTVELEGIFVQIGLLPNTEWLDGTIALSKHNEIEIDSHGATS
IPGVFAAGDCTTVPFKQIVVSMGAGSTAMLSAFDHLIRTSDASVPA
Download sequence
Identical sequences M4ZW26
gi|470176571|ref|YP_007562615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]