SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470176619|ref|YP_007562663.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176619|ref|YP_007562663.1|
Domain Number 1 Region: 19-253
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 1.01e-79
Family Nqo1 FMN-binding domain-like 0.00000042
Further Details:      
 
Domain Number 2 Region: 341-456
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 1.22e-22
Family Nqo1C-terminal domain-like 0.00087
Further Details:      
 
Domain Number 3 Region: 254-340
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 0.0000000000000602
Family Nqo1 middle domain-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470176619|ref|YP_007562663.1|
Sequence length 468
Comment NADH-quinone oxidoreductase subunit F [Ilumatobacter coccineus YM16-304]
Sequence
MSTAITRDYTPGFYEGDRPKIVTSRFEYEDSYTLERYLATGGYEGLKAALAKTPDEMSGE
VKASTLLGRGGAGFPAGVKWGFTPQGVWPRYLVVNGDESEPGTYKDRLLMERDPHQLIEG
CLIACYAAGLSQCFLYVRGEMALAHERIAAALNDAYDAGYIGKNILGSDFSVDIILHWGA
GAYVVGEETALIESLEGERGMPRLKPPYFPAAVGLYGQPTIVNNVETLANLPFIAANGSA
AYTAIGTETSPGTRMIAISGHVKRPGVYEIINGSTTFRDIIYGDEFCQGIRDDNELKAFV
PGGGSAPWFLPDQLDIPFEGREAGQAGSMLGSGAVMVMDETTDIPEAALTLTRFYAHESC
GKCVPCREGGTWLLRMLERVCSGHGTTADLDQMFQVGESICPGDMPHAASERLGLEATPF
PYKMTTICFVGPSAYAPLHSALTLFRDEFDAKVTESPKRISIPVTAAS
Download sequence
Identical sequences M5AGV8
gi|470176619|ref|YP_007562663.1| WP_015439973.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]