SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470176958|ref|YP_007563002.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176958|ref|YP_007563002.1|
Domain Number 1 Region: 9-283
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.48e-29
Family Galacturonase 0.026
Further Details:      
 
Domain Number 2 Region: 673-781
Classification Level Classification E-value
Superfamily CalX-like 1.57e-28
Family CalX-beta domain 0.00059
Further Details:      
 
Domain Number 3 Region: 293-332,403-671
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.63e-20
Family Galacturonase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470176958|ref|YP_007563002.1|
Sequence length 1161
Comment hypothetical protein YM304_07500 [Ilumatobacter coccineus YM16-304]
Sequence
MLVVGDGGPVGAATLTVDTASDDPADGLTLREAIDTAADGDTIVFDPSLAGATIEFDGLT
NGQLRIVTDLTITGLGRDALTLTSNDGDVLYIYNHSVTVTDLSIEAAPDDGIEVSDNGGG
PTLTLTRVDISGSSSDGVNFESVTGSVSISDSTLTENGSRGVAMNQVHDLTVMDSTLTGN
DSSAIYADDVYGDVMISGSTFDDNGRAGVGLEEVRGNLSVTNSTFTGNDNDAIYVDDFVE
GDVTLTDLELVDNGDAWSLQDVAGAAVTITDVTASATGVDTDNDMQLYADTGVATSPTLT
VSNVTGAGDDTSFRLYGFGDTTISNVELTGTNGAYLRARRMHGDVSITDSRVVGERYASL
YLYRAYDADISIDEVEVNGEVGMRRIYDGAINISNATVGSERDGGIEIRYASDVSISDVS
VSSPDDTGIELNYIESSVGASLPGDITIERATVSGAGDEGIRVRRAEDGVVTITDTEIAD
AGEVGLYLRYVGDMTLNRVTITGSEEEAVSADRGLGTLSIASSTLIDNGGAGDHALNLYD
GTVDIAHSTIAGNGAGASSGGIEVYAADVTIDHTILTENGGTAVFVDGPGSVTATNSLVP
VGSGLGASNVESDTADLSPVGDFGGETRVAPPLSGSAAVDAGDPAIAGEPATDQRGGPRK
IGTIDIGAVEVDPVSSVAVADATVDENAGVVSVEVERTGSVDLPISVDLATVDGSATAGD
DYTATTGTVSWAAGETGVKTVDVPITDDTIAEPSETFAVNLSNPVDTTISDAEATVTILD
VPPPLAALSPARLADTRAGKSTVDDDFNGDGKLGAGDEYKVQIAGRGGVPADAKAATINV
TAIGADSNGFVTVHPCLPTPPNASSLNYTAGVNLGNEVTVPLDANGAACFYTSSSVHLTV
DVVAFMPGEGRGMPLTPARLLDTRIGATTVDGRAAGRGRVPAGAFEQLSVAGRGGVPADA
AAVIVNVTSIGASGNGYVTAHPCLPTAPNASSLNVVAGVNRGNELIAQVDANGDICLFVS
TEMNLTVDVTGYIPNGTALNSVSPARILDTRANGETVDDMSEKEGKRSAGSEYTLQVGGR
GGVPGDAKAAILNVTAINPESVGFLTVHPCVSPRPEVAALNYVPGVNGGNEIVASLDASG
QACIYTSAAADITVDVVGYLA
Download sequence
Identical sequences M4ZXP2
gi|470176958|ref|YP_007563002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]