SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470176996|ref|YP_007563040.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176996|ref|YP_007563040.1|
Domain Number 1 Region: 89-196
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 6.15e-37
Family N-utilization substance G protein NusG, N-terminal domain 0.0000504
Further Details:      
 
Domain Number 2 Region: 211-267
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.69e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470176996|ref|YP_007563040.1|
Sequence length 267
Comment transcription antitermination protein NusG [Ilumatobacter coccineus YM16-304]
Sequence
MSKDSAADLLPTGTANVDADSDEAATADDQATDDATADASDDSKSEGDAGSAGDESASSD
DDAQAAEADAEADDVEEVPYDDPNKRPGKWFVVHTQSGYEKKVTANLNARIQSMNMEDKI
YEIVIPMEEVDEYKNGKKQTVMKKVFPGYLLVRCRMDDESWYCVRNTPGITGFVGQAAKG
QKPTPLSRREVKTFLSPKTEGVEAAPRRKAKLDYEEGESVRVKEGPFADFTGEIAEINAD
HMKLKVLVNIFGRETLVEMDFSQVAKL
Download sequence
Identical sequences M4ZX88
gi|470176996|ref|YP_007563040.1| WP_015440350.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]