SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470176997|ref|YP_007563041.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176997|ref|YP_007563041.1|
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.57e-26
Family Ribosomal L11/L12e N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 68-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 9.68e-25
Family Ribosomal protein L11, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470176997|ref|YP_007563041.1|
Sequence length 141
Comment 50S ribosomal protein L11 [Ilumatobacter coccineus YM16-304]
Sequence
MAKKKVAAVVKIQIEAGKASPAPPVGTALGPHGIAIMDFVKAYNAKTEDKAGTVVPTEIT
IYEDRTFDFILKTPPASTLIRAAAGLEKAANNPGSEVAGSITPAQVKEIAEIKMPDLNAN
DIEAAMLQIEGTARSMGIEVG
Download sequence
Identical sequences M4ZWP4
WP_015440351.1.75388 gi|470176997|ref|YP_007563041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]