SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177002|ref|YP_007563046.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177002|ref|YP_007563046.1|
Domain Number 1 Region: 55-126
Classification Level Classification E-value
Superfamily ClpS-like 2.27e-22
Family Ribosomal protein L7/12, C-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily Ribosomal protein L7/12, oligomerisation (N-terminal) domain 0.0000000000000432
Family Ribosomal protein L7/12, oligomerisation (N-terminal) domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470177002|ref|YP_007563046.1|
Sequence length 126
Comment 50S ribosomal protein L7/L12 [Ilumatobacter coccineus YM16-304]
Sequence
MSKDEILDAISALTVIELKELLDAFEEKFDVTAAAPVAVAAAGAPAAGGDAGGGEEQSEF
DVILNGAGAQKIQVVKVVKDLLGVGLKDAKDLVDGAPKPLMEKASKEDAEAAKAKLEEVG
ADVELK
Download sequence
Identical sequences M4ZWP9
WP_015440356.1.75388 gi|470177002|ref|YP_007563046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]