SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177047|ref|YP_007563091.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177047|ref|YP_007563091.1|
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily Ribosomal protein S8 1.24e-42
Family Ribosomal protein S8 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470177047|ref|YP_007563091.1|
Sequence length 133
Comment 30S ribosomal protein S8 [Ilumatobacter coccineus YM16-304]
Sequence
MLTDPIADMLTRVRNANTAMHDEVKMPSSKQKVALAAVLQAEGYIEGFETAPSPRGVGEV
LTIKMKYSEERERTISGIRRISTPGLRVYRKSNAVPRVLNGLGVAVLSTSNGLMSDREAR
KRKVGGEVLCYVW
Download sequence
Identical sequences M4ZWV8
WP_015440400.1.75388 gi|470177047|ref|YP_007563091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]