SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177188|ref|YP_007563232.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177188|ref|YP_007563232.1|
Domain Number 1 Region: 231-486
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.05e-18
Family Nitrous oxide reductase, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470177188|ref|YP_007563232.1|
Sequence length 512
Comment hypothetical protein YM304_09800 [Ilumatobacter coccineus YM16-304]
Sequence
MSRRTLISATVAVTLAASGVAVGTQFASGAGESSESIFVSITPCRLVDTRPGDINVGPRD
TKIGPDETATFTAWGTGDADSPCDIPATATAIATNTVAIAPTARSFMTLYPADVDNPGTA
NLNYTAGQAPTPNAANVPLSATGTFNVFNAFGEVHVVIDVNGYYQPSSNVGPQGPTGPQG
NAGRNGVNGSVGPDARDGVSNRISDEQIAELRWFEDPADPVTIAVESRPKAFASDGTYLF
VTTTDGVIVIDPSTNEQVDADPTTPGTQPIALDPGSGPLGIAYGNGRLYTANINFHTVSV
IDPTTLQRDGADIVLDPSTLPADLAVGDTQLVVSLNASDQVAVIDLATRAVELVSVGTEP
EQVVIVGNEAWVSGYDGNIAIVELDSLSTPAGFVSVGTSITGMIGTGDYVWATNGGEGSV
NKVEVASRQVVDIDPGIGTGIPASPAPRELAYDGRWLYLTEATADTVMVIDPVTHTVVGS
VPVDDPEDIYFDGTSVWVSNPAANTIQRLLPR
Download sequence
Identical sequences M4ZYB5
WP_015440541.1.75388 gi|470177188|ref|YP_007563232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]