SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177312|ref|YP_007563356.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177312|ref|YP_007563356.1|
Domain Number 1 Region: 9-290
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.7e-64
Family MoCo biosynthesis proteins 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470177312|ref|YP_007563356.1|
Sequence length 342
Comment molybdenum cofactor biosynthesis protein MoaA [Ilumatobacter coccineus YM16-304]
Sequence
MARGAHQALVDPFGRVIEDLRISITDRCNFRCTYCMPEEGMKWLHRSEVMSFEEIERLAR
IFVERYGVRGIRLTGGEPTVRAHLPVLVRKLAALENQHGAIDLSMTTNGATMRLVAEGLR
EAGLKRVNISLDTLIAEKFHQMTRRDELTNVLDGIVASQEAGFERVKINAVIERGVNDDE
IVDLATYGREQNVEVRFIEFMPLDATGHWLNDKVVGQDEIVEAISAVYPIEQMPARGAAP
ADRFRYLDGDGTSPGSMIGIIPTVTKPFCGDCDRVRLTAEGDFRTCLFATDEFDLLTALR
AGETDDQIAARIEAAVATKWAGHQINQVNFIRPGKSMSQIGG
Download sequence
Identical sequences M4ZXL7
gi|470177312|ref|YP_007563356.1| WP_015440665.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]