SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177494|ref|YP_007563538.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177494|ref|YP_007563538.1|
Domain Number 1 Region: 6-471
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.44e-162
Family Aconitase iron-sulfur domain 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470177494|ref|YP_007563538.1|
Sequence length 474
Comment 3-isopropylmalate dehydratase large subunit [Ilumatobacter coccineus YM16-304]
Sequence
MSETPSRPKTLPEKVWERHLVQSGDGEPDLLYIDLHLVHEVTSPQAFDGLRLSGRSVRRP
ELTIATEDHNVPTADIDQPIADPISAKQVDTLRANTAEFGITNFPMGDPNQGIVHVIGPE
QGRTMPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLPQERPKWMSVTVDGDL
QPGVTAKDVILAILGEIGTSGGIGHVIEYRGSAITSLSMEGRMTVCNMSIEAGAKAGLIA
PDQTTFDYLEGREQAPKGADWDAAVADWKTLYTDEGAVWDKEVVLDAASIAPHVSWGTNP
GQVISIDSLIPDPASFDNPTTRETVERALEYMGLEGGTSMRDVSVDTVFIGSCTNSRIED
LRAAAAVMEGRTVTVPRVMIVPGSHAVKQQALEEGLDQVFIAAGADWREPGCSMCLAMNP
DKLQPRERAASTSNRNFEGRQGPGGRTHLVSPAIAAATAVNGTFCTPADLEVRS
Download sequence
Identical sequences M5AJT9
gi|470177494|ref|YP_007563538.1| WP_015440847.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]