SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177834|ref|YP_007563878.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177834|ref|YP_007563878.1|
Domain Number 1 Region: 23-234
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.32e-28
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470177834|ref|YP_007563878.1|
Sequence length 253
Comment hypothetical protein YM304_16260 [Ilumatobacter coccineus YM16-304]
Sequence
MTSLDDSSTDVSTSDGAELVAKKKHSLALRWMHWINFPVLMVMMWSGMRIYWADLRDPYA
FGFFGWELFEFWPDGVNGFLELERKLAKGIAFHLVFGWFFVANGVAYAIHLSRNGNWRYL
IPDTQGVKDASKVVLHDLHLRDEAPPQGKYNAMQQLTYTAVIVLAAVLVATGFAIYKPGQ
LALLEAAFGGYDHARFIHFSVTVLLILFFFVHLVQVARAGWRNFTSIITGYRLERRSELL
PPVDDEQKGSVDT
Download sequence
Identical sequences M5AKR6
WP_015441187.1.75388 gi|470177834|ref|YP_007563878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]