SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177837|ref|YP_007563881.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177837|ref|YP_007563881.1|
Domain Number 1 Region: 83-342,378-424,464-493
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.6e-38
Family Pectin methylesterase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470177837|ref|YP_007563881.1|
Sequence length 512
Comment hypothetical protein YM304_16290 [Ilumatobacter coccineus YM16-304]
Sequence
MQTRARGFKAVTLAIGAAMLVAACGGSDGSANLADEPEAVGTAAPEPTDPPATDAPEPEP
TDPPATDAPEPEPTDPPATDAPGPGDDGVLDVPAEFTTITEAVDAAQPGDLVLIAPGTYN
EAVNVVTDEIVIRGLEREGVVLDGQFELDNGIRVLGARGVAVENLTVQNYTDNGVFFTGV
DGYRASYVTAYRNGDYGIYAFDSVTGQIEHSYGAGSPDAGFYIGQCYPCDAVVDNVISEH
NGLGYSGTNAGGNLIIANSRFNNNRAGIVPNSGSYELCYPQRQNLIVGNTVYSNNQPDTP
AIDVAILAMGNGILIPGGVGNTVERNLVYDHDRTGIGLVPFLEEGANDDIPEQSEWDTPC
SEQRLEPPATEIPESLLWDSFDNVISDNVVSDSREADLAVEGVGQPTGELRNCWSGNTFA
TSAPAALETIAPCGTDAAAPDDAVWETEALNVLRWLGEVDSRPEPVDYETAPLPPLPDLD
DMPDAATAPAQPATDVPFAIDTDAITTPVADG
Download sequence
Identical sequences M4ZZ88
WP_015441190.1.75388 gi|470177837|ref|YP_007563881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]