SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177838|ref|YP_007563882.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|470177838|ref|YP_007563882.1|
Domain Number - Region: 116-165
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 0.00549
Family Aconitase iron-sulfur domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470177838|ref|YP_007563882.1|
Sequence length 278
Comment hypothetical protein YM304_16300 [Ilumatobacter coccineus YM16-304]
Sequence
MKRLLAAALLLGACASSADEPVSGDPDPARVGPQGRVAQFIVECEVSHIAFDDPIVLPWQ
PGLSHQHQFFGNSATNSDPGYERAIGADTSCDQRLDTASYWSPTLLGPTGERIDALSMTA
YYRPGDGIAPQDVVAYPPGFMMIAGDSQAEEVQSIDVVAWGCGSGAQRTDRPQDCREDST
LRLWLTFPDCWDGSRLTSFGSGAHVRYSSNGCPESHPIAIPQLQMAIDFPPVPAEGLSLS
SGDTATAHADFWNTWDQEKLEREVALCLNRDLVCGVSG
Download sequence
Identical sequences M5A089
gi|470177838|ref|YP_007563882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]