SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177879|ref|YP_007563923.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177879|ref|YP_007563923.1|
Domain Number 1 Region: 68-270
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 5.63e-62
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0018
Further Details:      
 
Domain Number 2 Region: 259-412
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 0.0000000000122
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470177879|ref|YP_007563923.1|
Sequence length 426
Comment putative acyl-CoA dehydrogenase [Ilumatobacter coccineus YM16-304]
Sequence
MTDTQQRPAIDPNISIEDFEAEALAWLEANAEPRPDASGPIEWGNGEFSVSVFHAMDHDT
ELEYITNIQNWVIKKAERGYHAIAAPVEYGGLGLSRKHARAYGRLERKFKSHGKHELLGV
TTGLIAPTINVFGTDEQKQRFLPDLMSARTLACQLFSEPGAGSDLAGLACRAERDGDEWV
INGQKVWSSGAQFAQWGELIARTDVDEVKHKGMTAFMIPLDLPGIEVRPIHQMSGGSSFC
EVFFNDVRIPDDLRIGDVGAGWSVALTTLGFERDHSESGSEGAAAGGTWKQLLATAQHEG
VTADPVMRDKLMQVYIKDRIESMVNRRAADLAKSGTPGPEGSLGKLLWTEGMYAMTEMIS
AVLGPKLIADSGEWGTFEWGEHVLGAPGYRIAGGSDEVQRNIIGERVLGLPREPKADTGP
WKDVPR
Download sequence
Identical sequences M5AKV7
gi|470177879|ref|YP_007563923.1| WP_015441232.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]