SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470178178|ref|YP_007564222.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470178178|ref|YP_007564222.1|
Domain Number 1 Region: 14-311
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.24e-73
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000437
Further Details:      
 
Weak hits

Sequence:  gi|470178178|ref|YP_007564222.1|
Domain Number - Region: 327-362
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0157
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470178178|ref|YP_007564222.1|
Sequence length 374
Comment cysteine--1D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase MshC [Ilumatobacter coccineus YM16-304]
Sequence
MTFTLYDTARRAIVPFEPGEQVLMYTCGITPYDATHLGHAATFIAYDTLQRHLIDKGHTV
KCVRNVTDVDDPLFEKARELGVHYLDLAAGEEARFERDMVALNALPVASSPRASSAIPDI
RGFIGMVIDRGFAYEAGGSVYFDVSKVESFGSMSQYTEAEMLAYARERGGNVDDPNKRNQ
LDFVLWHPSAPDEPSWDTLWGPGRPGWHIECSALALRELGTTIDLHGGGADLIFPHHESE
KAQSEAATGEPFVKHWMHTALISMDGQKMSKSLGNLVFVDKLRETYDPRAIRLGIVEHHY
RTEWEWDEELMPRNDARLQTWRAHATSNPELLDEVRARLDDDLDTPGAFAAIDAAAAAGD
GVLEASELLGVPLD
Download sequence
Identical sequences M5A172
WP_015441531.1.75388 gi|470178178|ref|YP_007564222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]