SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470178221|ref|YP_007564265.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470178221|ref|YP_007564265.1|
Domain Number 1 Region: 4-226
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.42e-32
Family Carbon-carbon bond hydrolase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470178221|ref|YP_007564265.1|
Sequence length 232
Comment putative hydrolase [Ilumatobacter coccineus YM16-304]
Sequence
MTKVMLVHGWAGSFEATWQRNGFTALLEDGGKDVIGVDMLGHGTAPKPHDPDAYADLTER
LVEALPPGDETVAAIGFSLGAMTLIRTAIAHPHRFERLVLAGVGRNIFDRDHSGAQQISE
GLDALIAGADPATLDQSARLFAQYAQQPGNDLEALAAVMRRPAGTEISRDTLTAITCPVL
VVIGADDFAAPGDELAAAFPDGRCVTLPKTDHFATTESFGFFDAALEFVGAA
Download sequence
Identical sequences M5A0P4
WP_015441574.1.75388 gi|470178221|ref|YP_007564265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]