SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470178307|ref|YP_007564351.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470178307|ref|YP_007564351.1|
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.26e-31
Family Thioltransferase 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|470178307|ref|YP_007564351.1|
Domain Number - Region: 127-170
Classification Level Classification E-value
Superfamily TPR-like 0.000467
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470178307|ref|YP_007564351.1|
Sequence length 235
Comment putative thioredoxin [Ilumatobacter coccineus YM16-304]
Sequence
MTAIDVTDATFETDVLEKSNEVPVVVDLWAEWCGPCKTLGPILEKVIDATDGKVVLAKID
VDANPALNQAFKVQSIPAVYAMKNGAVVDGFMGAYPESAVQEFVDKLLPSQEEVAVSELL
AAGDEGSLRLALSMEPANEDVIVALGELLVANGQNDEALELLSRIPESERTRHVAASARI
GEVPDDDHDATLTALLDSVKTDDEARQKFVDILELMGPEDPRTADYRRQLTLRLY
Download sequence
Identical sequences M5A0P1
gi|470178307|ref|YP_007564351.1| WP_015441660.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]