SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470178647|ref|YP_007564691.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470178647|ref|YP_007564691.1|
Domain Number 1 Region: 10-523
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.06e-155
Family Aconitase iron-sulfur domain 0.00000000000867
Further Details:      
 
Domain Number 2 Region: 517-755
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1e-47
Family LeuD-like 0.000000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470178647|ref|YP_007564691.1|
Sequence length 758
Comment aconitase [Ilumatobacter coccineus YM16-304]
Sequence
MPVSASTPIELVDAVYANLPGNVQIARDRLQRPLTLTEKILVNHLSDPENQSLERGESYA
DFHPDRVAMQDATAQMALLQFMTAGLDEAAVPSTVHCDHLIQAKVGAQIDLGVAVDTNKE
VYDFLRSVSAKYGIGFWGPGSGIIHQVVLENYAFPGGMMIGTDSHTPNAGGLGMVAIGVG
GADAVDVMTGFAWNVKWPKVIGVKLTGTLSDWSAPKDVILEVARQLTVKGGTGAIVEYYG
PGADSISATGKGTICNMGAEIGATTSLFGYDTNMSEYLKATGREAIADAADKVADHLRPD
DGAMYDQIIEIDLDELKPLINGPHTPDLAHKVGAGVGEAARANDWPLVPSAALIGSCTNS
SYEDITRAASIARQAAAKGLTSKIDLMITPGSEQTRATIERDGLLADLEAIGATVLANAC
GPCIGQWSRPEAVTGQINTIVTSYNRNFPKRNDGSANTLAFVTSPDTVMAIALSGRLDFD
PTTDTITAPDGTEVSLDAPVGQILPDAGYDPGEDTFTAPPADGSTVEVQVSPTSDRLQLL
EPFEPAPRDAYNGLPVLVKAQGKFTTDHISMAGPWLKFRGHLENISGNLYLGAVNAFSKG
DGSGYEVGYGKNQLTGETQTFPEIAKEYHEAGQPWVVIGDENMGEGSSREHAAMEPRFRL
GLVAIARSFARIHETNLKKQGMVPLTFADAADYDKIDEDDRINVLTLPPVPGENVKCQIV
KPGGTTIDFEAKHTFSPEQVEWFEAGSALNIIRQKSAN
Download sequence
Identical sequences M5A1S2
gi|470178647|ref|YP_007564691.1| WP_015442000.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]