SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470178759|ref|YP_007564803.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470178759|ref|YP_007564803.1|
Domain Number 1 Region: 19-238
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 9.56e-59
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0011
Further Details:      
 
Domain Number 2 Region: 226-385
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 0.00000000000122
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470178759|ref|YP_007564803.1|
Sequence length 403
Comment putative acyl-CoA dehydrogenase [Ilumatobacter coccineus YM16-304]
Sequence
MTTIDAETDLTADEQRVSDLITDLLEQFPPNDTDAATFLGQQFDRGLAWVHFPEGNGGLG
LNPKLQRMINERLQAAGAPNAMIRNPIGHGMCGPTVVTWGSDDQKSRYLRPMFTGEEVWC
QLFSEPGSGSDFAGLSSTGVRDGDEWICNGQKVWTTLAHLSRWGLLVVRTDPQAVKHAGL
TAFVVDMQDPTVEVRPLRQMTGEAEFNEVFFTDTRIHESEMLGSPGDGWRVSLTTLMNER
VSIGGTIPAKGSGMISALTKAWAEAGDHLKTGAALDEVMSLWSRAEVARLTNIRSSQNRK
MGDPGPEGSIGKMAAADLNKEIYEKVMDLMGADALLYGSYEMIRPETAMGSDTPQKAFLR
VRANSIEGGTSEVMRNILGERVLGLPGDVRVDREVPWSEIPRN
Download sequence
Identical sequences M5ANS4
WP_015442112.1.75388 gi|470178759|ref|YP_007564803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]