SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470178761|ref|YP_007564805.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470178761|ref|YP_007564805.1|
Domain Number 1 Region: 12-101
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000237
Family HtrA-like serine proteases 0.088
Further Details:      
 
Domain Number 2 Region: 86-237
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.00000000628
Family MoCo biosynthesis proteins 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470178761|ref|YP_007564805.1|
Sequence length 480
Comment hypothetical protein YM304_25530 [Ilumatobacter coccineus YM16-304]
Sequence
MSATLHRSLAPLVVSVAPGSPAALAGVVEGDEIVRVNGDEPRDIIEWQMATDEAEVELDV
LRGGLDLSMSIEKPEGAPLGIEVSSAVFDRVRTCDNHCEFCFIYQLPKGMRRSLYLKDDD
YRLSFLYGNFTTLTRFTEADLERVVTERLSPLHVSIHATDPDVRSHMLKNPRGAMSLRWL
RALLDHDIVVRGQVVVCPGVNDGAIFDDTMAGVLDQYPELDSVAVVPLGISKFNGEDAMR
LHTRAEAAAMVDAVTDWQDVFSATLGRRMVYAADEYYLMAGRPFPDAERYDGFPMHEDGI
GMARTFEREFHGHAVEATGPQRGFFAAVDAPPNPAAYTGLRTAVPCGSGDDAATGGTTAA
ATAVSLSPRRTAPIGVLTGPLGAPVIQPLVDALGRDDVRVITVTNEFFGGNTGVTGLMTG
DDLTRTLADQPDGHRYLIPDVCLSDDGRFLDGVTVSELPRPVEVIATDGIALRAALEGTS
Download sequence
Identical sequences M5A296
WP_015442114.1.75388 gi|470178761|ref|YP_007564805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]