SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179172|ref|YP_007565216.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179172|ref|YP_007565216.1|
Domain Number 1 Region: 285-539
Classification Level Classification E-value
Superfamily Radical SAM enzymes 6.28e-54
Family Biotin synthase 0.01
Further Details:      
 
Domain Number 2 Region: 4-209
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-51
Family LplA-like 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470179172|ref|YP_007565216.1|
Sequence length 556
Comment octanoyltransferase/lipoyl synthase [Ilumatobacter coccineus YM16-304]
Sequence
MSDPLRVRWLGTVPYREALAVQESLFAHGTGQHLLLLEHPHVFTYGRTADLATNLKCEPA
AVGAELVPVKRGGDITYHGPGQLVGYPILNVENSMGASDHVCGVEGLIIDALAELGLPHA
GRLAGYAGVWLDAGTPAERKICAIGVRLRRGRTMHGFGLNVTTDLNYMREHIVPCGIGDK
PVTSLAEEGIAVSVRDVADVISRLAAERWGGGAVERQDVAWAHAADGRDLSAFSRGEGPG
EQVKLVSSRATARMEAAGVTDGLSIETRKPDWLRPKVELGPEVMDLKKTIRSLDLVTVCE
DAGCPNLSDCWSDGTATFMVLGERCTRACGFCLVDTSKPLAPAADEPQRVAEAIDRMALD
HAVLTMVARDDLADGGMAHVAACVEAIRLRRPQARIETLISDAKGDDSSLDLLFASRPDV
MNHNVETVARLQRAVRPSAGYARSLGVLARAKAAGLTTKTGFMAGLGETDDEIVGLLADL
ADLGVDIVTIGQYLRPTSHHLPIARYAEPAEFERWKQIGEAFGIGHVEASPLTRSSYHAK
SSADAVVEPVPVSLSR
Download sequence
Identical sequences M5A377
gi|470179172|ref|YP_007565216.1| WP_015442525.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]