SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179299|ref|YP_007565343.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179299|ref|YP_007565343.1|
Domain Number 1 Region: 74-440
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000202
Family Pectate transeliminase 0.089
Further Details:      
 
Weak hits

Sequence:  gi|470179299|ref|YP_007565343.1|
Domain Number - Region: 395-567
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000298
Family Galacturonase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470179299|ref|YP_007565343.1|
Sequence length 703
Comment hypothetical protein YM304_30910 [Ilumatobacter coccineus YM16-304]
Sequence
MGRRWSQRRRRETGSLPSRVMVAERVASPRRSASGRRGGAARARAALVAGLVFASVGVAA
HTNPTIEAAGIVFVVDSTADDVDAAPGDGICDTGTGGATPVCTLRAALDEADARPGHDTI
EFAIPGPGPHRLDPASMYPRIDDPAGVTIDGYSQPGASPNTLATGTDAVLMIEIRGRGPD
AIDGFDIRSANNVITGVSMFDFVRHIRIFGSAAHDNRVVGNFLGTDASATFGQVARQTNA
NAVHIERGASANRIGMPGAANRNLFAGNADKGVAMFDSGTQFNLVQNNLFGLTPDGSARL
TNWGHGIDINFNASYNVVGGWNPGEGNVVAGSELSGIEISHNVGTGVTTGNQVVNNLIGT
VPDGSAAPIYAGNREFGINFEGKPRCADSCPVDISGNLAAGNVVVGSNADVMFWKGANDN
LVVDNIIGVLADGSPAESSAATTWGVLIQAGAFDNRVERNTIAGVPRGVMIKPDNDFPSE
CLASDVVCPEDASFPTYGNTLSRNSIRDIGPGLGIDLSAGGFSSGPDDPPTADVQGGIAI
PVVTEVTTDALTATTCAGCTVEVFVTPTPACTGCFEAYGRGERWVADGTADAAGDVTVTF
RSDPVDAYVVLAGSQVAIHTTDAAGNTSEHSLRHTVTAGLIAPPASPTTTISPGSSTSMV
SLPPTTMAPTTTTTTLVSASMFMIRGPASADVRAVRCTLDGTC
Download sequence
Identical sequences M5AQB6
gi|470179299|ref|YP_007565343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]