SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179473|ref|YP_007565517.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179473|ref|YP_007565517.1|
Domain Number 1 Region: 3-256
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.75e-62
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00094
Further Details:      
 
Domain Number 2 Region: 242-399
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.77e-34
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470179473|ref|YP_007565517.1|
Sequence length 432
Comment putative acyl-CoA dehydrogenase [Ilumatobacter coccineus YM16-304]
Sequence
MAWDFETDPEFQEHLDWMDEFVTNEVQPLDLVLDDPYDKSDTAGLELITPLQEQVRERGL
WACHLGPELGGPGYGQVKLALMNQILGRSRFAPTVFGCQAPDSGNAEILAHYGSDAQKER
YLQPLLDGKISSCYSMTEPQGGADPTMFTTTAVKDGDEWVINGEKWFSSNAKFASFFIVM
VVTNPDVSAYEGMSMFIVPAETPGVKIIRNTGIGNETEAEGSHAYMHYDNVRVSNDHLLG
DPGAAFAIAQTRLGGGRIHHAMRTIAQVEAAFAMMCERALSRETRNGPLASLGVVQEQIA
DTWIEIEQFKLLVLRTAWRIDKYNDYRKVRKDISAVKVAMPKVYHDVALRAMHLHGALGV
SNEMPFTGMLIASEVMALADGPTEVHKTTVARQVLREHKPVDGLWPSAHIPARKAAAREK
YAAYFEREAADH
Download sequence
Identical sequences M5A577
gi|470179473|ref|YP_007565517.1| WP_015442826.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]