SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179520|ref|YP_007565564.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179520|ref|YP_007565564.1|
Domain Number 1 Region: 48-341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.52e-70
Family Tandem AAA-ATPase domain 0.00011
Further Details:      
 
Domain Number 2 Region: 541-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.56e-59
Family Tandem AAA-ATPase domain 0.000000631
Further Details:      
 
Domain Number 3 Region: 798-1006
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.32e-48
Family Tandem AAA-ATPase domain 0.0000011
Further Details:      
 
Domain Number 4 Region: 1013-1125
Classification Level Classification E-value
Superfamily TRCF domain-like 1.2e-27
Family TRCF domain 0.0007
Further Details:      
 
Domain Number 5 Region: 490-564
Classification Level Classification E-value
Superfamily CarD-like 1.7e-20
Family CarD-like 0.00056
Further Details:      
 
Domain Number 6 Region: 391-486
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000031
Family Tandem AAA-ATPase domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470179520|ref|YP_007565564.1|
Sequence length 1157
Comment transcription-repair-coupling factor [Ilumatobacter coccineus YM16-304]
Sequence
MTDVADDLIAGEVDSAERIAPLVSLAPLLRDEPGLTRALADPGARLAVVEVARPISIAAL
ARLSNRRPLVVACPTGTMAAQLHDDLQQFVAPDELALFPGWETLPFERVSPNVETMGQRL
DVLWRLRDPERCPKVIVAGVRSLLQKLGPGAMSVEPIVIRPQTEIDPDILVKTLVRFGYR
REELVEHRGEFARRGAIIDVYPARASAPIRIDLWGDEVDRLTRFGVNDQRSVADLDEALI
FPARELIPDERVQERARTLMASEPWGREQWERLAEGAHFDGMESWLPWLVDDDVLLTDVL
PDDAKVVLLEPRRMRDRAADLIAEEDDLARTLASTWARDPDKTFPRLHADPDVLLASAGS
FWSIDSTPESPDTPLVEAMGWGPVVGDGTGLTDRLRDLIADGYRVVVAADGEGSARRLHS
MLLDQGLDFALRVGPKADLTVDIPVGGSIIVAPLHRGATLPNAKVAIVAESDLTGRRRAH
RQARPRKRSETASTFEDLKAGDYVVHQQHGVGKYDGMVKRAIGGVERDYLLLSYKGGDKL
YIPSDQIDTIRQYVGGEAPKLHKLGGSDFAKTKSRVKSEVRQIAQELVLLYQQRVTAEGH
QFAMDTPWQAEMEDAFPFVETPDQRTAIDEIKADMERGFPMDRLVCGDVGFGKTEIAIRA
AFKAIQDGKQVAVLAPTTLLATQHGNTFADRFAGFPIRVEVLSRFLTAAQAKKVVNDVKS
GEVDCVIGTHRLLAADIHFKDLGLLVVDEEQRFGVQHKEKMKKLKTNVDVLTLSATPIPR
SLEMSLVGIRDLSLLQTPPAERQPILTYVGEYDERVAIEAIRRELLREGQVFWVHNRVRS
IDSAASRLRELVPEARIAIAHGQMDEGSLENVVQDFWDGQYDVLVCTTIIESGIDMPAVN
TLVVERSDLLGLGQMHQLRGRVGRSGQRAYAYLFHPRDKTLSEEAYERLRTIGEATELGS
GFKIAMRDLEIRGAGSLLGESQSGHIAAVGYDLYCQMVTEAVSEMKGEPLPNAPTEIKLD
VPTDSFLPDDYVKKEESRLEAYRRLADVTSQAQVDDIRAEWEDRYGPLPAPAESLLQVGY
LRAECHRLGVTDLQITSSDARIQPIELKMSATLRLRRLSKGAKYKEDLHQLVVPLPRGKD
AATFLVGFFRDLVPDDD
Download sequence
Identical sequences M5A5H7
gi|470179520|ref|YP_007565564.1| WP_015442873.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]