SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179623|ref|YP_007565667.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179623|ref|YP_007565667.1|
Domain Number 1 Region: 840-1146
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000994
Family Galacturonase 0.056
Further Details:      
 
Weak hits

Sequence:  gi|470179623|ref|YP_007565667.1|
Domain Number - Region: 1574-1641,1760-1884
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00733
Family Galacturonase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470179623|ref|YP_007565667.1|
Sequence length 1944
Comment hypothetical protein YM304_34150 [Ilumatobacter coccineus YM16-304]
Sequence
MVLSKRRVGAVLIAVASLVGSMLVPVTVAAETHTGAVHATAELSVAPAYQAVPVARVADT
RGDVTAALQVPIGRLTPGVPLVLDLAGEAGIPNDGVAAVDLNVAVTAVARTGYLAVYPCA
DGDDGTARLNYTAPATGSSAIAVQVLAQLDVDGAVCIAASAPAHVIVDTSGYLADGGPLR
PLAATRLFDTRTGDGAVAVKTAKPAVETPFPIEVAGVAGVPESGVSAVLLSVAAVKGTAP
GFVSVYPCADGYQGTANLNHRVTDPVANSVIAPLDENGEICFYNSASVDLVVDISAWFAD
DGGFEALEPTRVADTRDGVGDIPIGRLTPFEPLAITLAGEGGVPPTGVDAVSLNVAVARS
TAAGFLAIFPCDEEWNGTASLNFRLGEPISNAALTPLAADGTACVLASSPVDVIIDVNGW
FGNGEQAVDDEFAIDEDSGFNQFDVLANDVGTDTVTAVTQPANGSVAITNDGDDVRYIPQ
ANYCNTGDEPDEFTYTAEPGPTTATVSVTVTCIDDAPSAVDDASTMTEDAATTSIDVLSN
DTDVDGGPISIASVTQPGDGVATTDGATVAYTPDADACNDGSPTDDFIYTLAPGGGTATV
SVTVTCVPDAPVAVDDEGVGFVIAEDDTPLTIMPLANDTDVDGGPISIVAITDPVNGTAE
ITNGGADLTYEPDPGYCNDGSPTDDFTYTLEPGGSTATIAMAVTCVNDAPLAVDDVFASD
VTPGSANDRNAIGNTTLKVGAAAGTGIERAVAGSLLDNDTDGDAGQADADTLSVSDVEAV
GGAAPFTATTAEGGTVVVDDDGTFVFTPAPGFGSDVAPLPTDSFEYTITDGTATSTATAT
IEVSAPVWYVDSAAPAGGDGRSTSPFDGLDSLNGETADLDDPGDTIFLYTGSVYEGGLPL
QTDQRLIGEPVGLSADGTQLLAPNGGVLRPEITTTGSGEIGIELASGVIVDSVATRNTGS
GPSGRGDGWSADGVGDISLHHVAHFGVGFHGFDIDGLVGDLAVTGTLAVFPAVEGTTSAD
AVAIAGSTPAASVTIDDLAVFGSGSGGVVIAGNAGPVTITDGSIHGNAGTGLSILTGSAA
VSYGGTVGVPVSNDGAVSISGRQGTTTLTGAISDSGGTGVGILNTASGSTMFSGAIDLND
GAGLHLVGNADGSTSFDGPVTITGGTGISVTTPASSTASTTFSEYVDVDITTETGVHVSS
ANPSAAVVAFEGGLEVDTTSGTAVSTSGGRLDIVDSTGQGETLRTTSGIVLSMNNTSGTI
DLESVDNVLATGVGTVILDSVGSVDLGVATLDGQHVAGGGGFRYGQVITVDGATRFATDP
ASAITGTTVGSVNLANVTDLAFAAASLTSTPDNGGSGVVLTDIAAGTFAVSGQTSSVGGS
VGVRVTRSAADVTMGSLVLGDAVTAFGTYGVVLDDVSGSVDIDGGAIQNALSRAVWVTGG
SGAVSYAGTVAADTGHSVRVQDRTSGLVEFTGLVSASGPASGVDVSNVSGGVSFVGGIDI
DVSSSLPAFQAVGSAITVVSPASGTNELSNTGGGAALVLTNSTIPVAGVTFDSVSAGGAG
GAVSIFGVDGPGALTLDGGAITGDTAANAISLWNTTAPITISSMTVDGSAGRAVYAQNSA
DVTISDISITGFGGDAAIAAIANGTAGAFTLTASDGQHSTITQPGPNGRAVDVRNFGTTD
MTAVVERLVTNGGATGVFLRGEGTGEFLATVGHPGADDPDDTTGGAPANVTITDPSDVAV
DLEIFASVSTRVLLDDVEHSGAPASTGGLAVDVTAIGSGAELDLVIEDSSLQPTSGSGID
MNYDTSAAFQTALDVLLRRVDAGGDGLTAEVANAAEMNIVATDSTFSGATTGAALTVPGA
GGLAAAMCLDLSDNSFSGATNDVTIDGQGARYSMVDLAGSLPADVQTWLDASNDDGGDPG
TALETVIADTGYSSATTCTQATAP
Download sequence
Identical sequences M5A5M9
WP_015442976.1.75388 gi|470179623|ref|YP_007565667.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]