SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179686|ref|YP_007565730.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179686|ref|YP_007565730.1|
Domain Number 1 Region: 5-237
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 3.4e-57
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000938
Further Details:      
 
Domain Number 2 Region: 256-403
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.93e-49
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470179686|ref|YP_007565730.1|
Sequence length 406
Comment acyl-CoA dehydrogenase [Ilumatobacter coccineus YM16-304]
Sequence
MTDFSMKLNEDQLTLQKWVHDFAETVVRPAGEEWDEKEEFPYPIVEQAKEIGLYSWEFMA
EAMMNDPTGLSMPIAIEELFWGDAGIGMAIMGSGLAAAGIASSATPEQLMEWVPQCYENA
DTGKLALGAFCASEPDAGSDVGGYRTSAKYDEKTDEWVLNGTKAWITNGGISDIHVVVAV
VDPELGSKGHASFVVPPGTKGLSQGQKYKKHGIRASHTAEVVLDDVRVPGRCLLGGKEKL
DERLAKVRRGEKGNAQAAMQTFEATRPAVGAQALGIARAALEYSTEYAKERHAFGRPIIM
NQSIAFMLADMAVEVEASRNLIWRAAWLGKQRGFKHAEGSMAKLKAGRTATWVTERAIQI
LGGYGYTREYPVERWHRDAKIHDIFEGTEQIQQLVISRAISGLRIE
Download sequence
Identical sequences M5A4W2
WP_015443039.1.75388 gi|470179686|ref|YP_007565730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]