SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179723|ref|YP_007565767.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179723|ref|YP_007565767.1|
Domain Number 1 Region: 87-168,251-516
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.01e-42
Family Pectin methylesterase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470179723|ref|YP_007565767.1|
Sequence length 603
Comment hypothetical protein YM304_35150 [Ilumatobacter coccineus YM16-304]
Sequence
MTNRWRLFSERSSGHRDTDAVERAAFVAAPSGCGLPTFMTTHDTIPETATLDEPRPRRCV
GTRSIIAVVLAMAVLITPLAFDEGSTAHAAARTWVVAPWGDNSASGSASDPLKTVGWAVA
RARSGDTVVLRGGVYNEQVQVYRKTLHIRSQPGERAVLDGAVAVDDWSPSGGDWYSSGWT
QQFYREVSGGVVDGDNIVAGYPDQMFIDGRTLTQVLQRSDVRPGTFFHDTDADRLWIGDD
PTGARVEASKLRFGFYFNRADGSTLTDVTVRRYATEARHMAAIRAYSDNLVFSGVTSELN
ARIGISAIGSGIVIRDSRFVDNGHLGVHGDRLTTFVVERTAVKGNNKAGFDTFHSAGGLK
VTSSRGVTIRDSDVSRNNGPGIWTDLDTEYVTISRNLVERNGRAGIEIELSRSVNVLGNV
TLDNGEAGIWVLESQDIQVLHNASYDSKNAIEVEEGPRRNVRNVRVFNNVLARAKGGSLA
LLAVNDWTEERSAAQMGVRTGYNAYWVPSTSETANLSRWGQWPSSPAYSQDLREHQQVTG
QGVGSLVDTSGSNPFVRSTDTLDYRSPSTTAAGAAVAGSAAAELGVPSGSRPRIGPLSVV
VRR
Download sequence
Identical sequences M5A5W7
gi|470179723|ref|YP_007565767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]