SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179855|ref|YP_007565899.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179855|ref|YP_007565899.1|
Domain Number 1 Region: 10-228
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 4.8e-91
Family Uracil-DNA glycosylase 0.00000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470179855|ref|YP_007565899.1|
Sequence length 260
Comment uracil-DNA glycosylase [Ilumatobacter coccineus YM16-304]
Sequence
MRSWFNGLVMTTTDWNPLLRSEFDKPYWAELQAFVATERREHTVYPPHDDVFTALRLTPH
AETKVVIIGQDPYHGPQQAHGLAFSVRHGVRIPPSLRNIHKELHADLGLPVPAHGNLERW
ARQGVLLLNTSLTVRAGQAGSHSGKGWETFTDQVIDVVNDTADPVVFVLWGNHARRKAAR
IDTRRHRIIESAHPSPLSARNGFFESRPFSRANALLAELGRDPVDWNLVDEPGTDLAGDH
TGVQTDGTSVGTSGLGSGTN
Download sequence
Identical sequences M5A6F0
gi|470179855|ref|YP_007565899.1| WP_015443208.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]