SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179993|ref|YP_007566037.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179993|ref|YP_007566037.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 1.31e-40
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00037
Further Details:      
 
Domain Number 2 Region: 160-314
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.01e-29
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00058
Further Details:      
 
Domain Number 3 Region: 316-418
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 3.27e-18
Family Glutamyl tRNA-reductase dimerization domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470179993|ref|YP_007566037.1|
Sequence length 419
Comment glutamyl-tRNA reductase [Ilumatobacter coccineus YM16-304]
Sequence
MSILVVGVNHRSGPLPLLERLTIAPDDLGKAVAGLAMRDSIREAVVLSTCNRTEIYVVAE
LFHGAYADVRDFLCELGDIDRDELTKHLFSEHDAAAVTHLFEVAAGLDSAVLGESEILGQ
VRTAWEVAQAESAARTTLNLLFRSAIETGKRARNETAIGRGTASVSHAAVEMLHDVVGDI
ADKRVVVVGAGSMGEGVAIALRKAGGAQITVVNRSPERGAALAERVEGTAVGFDALPSSL
AEADVVIAGTGSGEPLITEPLVTAARAGSTSELHVFDIGLPRDVEASVADLGGVTAFDLD
DLRDWADRGRSNRELEAENVRAIVREEVENFGVESTARQAAPLVASMHVAAEAVRVSELE
RYALRLAGLDDSERKAVEALTKAIINKMLHEPSVRLKSQAGTPQGDRNAAAIRDLFDLG
Download sequence
Identical sequences M5A6P6
gi|470179993|ref|YP_007566037.1| WP_015443346.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]