SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470180029|ref|YP_007566073.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470180029|ref|YP_007566073.1|
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-41
Family G proteins 0.0000745
Further Details:      
 
Domain Number 2 Region: 177-264
Classification Level Classification E-value
Superfamily Translation proteins 5.08e-19
Family Elongation factors 0.001
Further Details:      
 
Domain Number 3 Region: 267-356
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.000000000112
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0048
Further Details:      
 
Domain Number 4 Region: 519-564
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000112
Family C-terminal fragment of elongation factor SelB 0.01
Further Details:      
 
Weak hits

Sequence:  gi|470180029|ref|YP_007566073.1|
Domain Number - Region: 418-461
Classification Level Classification E-value
Superfamily AhpD-like 0.0655
Family Atu0492-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470180029|ref|YP_007566073.1|
Sequence length 572
Comment selenocysteine-specific elongation factor [Ilumatobacter coccineus YM16-304]
Sequence
MTVIATAGHVDHGKSSLVLALTGTDPDRFDEEKRRGLTIDLGFAHTTLPSGTELSFIDVP
GHVKFLRNMLAGVGGVHACVFVVAATEGWKPQSEEHLRILELLGIRHGIIALTKTDLVDD
DILEIAQMDVSDRVDGTFLDGAPVIPVAATAGVGLDEMRAAIDDLVERSGGALDRGRPRL
WIDRVFAAKGSGTVATGTLVGGALHADENVRIEPGQRTARIRSIQTAGRTVDQIGPGNRV
AVNLSGVDHAELARGHAVVEPDRWHLTDRFDASLDVLASLDHEVSRRGAYVAYLGAGEHA
VKMRVLGSEALLPGTSGAIRLFLPEALPLLPGDRFILRESGRDETVGGGEILDVDPVLRA
SRAAPDRTIERVVREREWVTVDQLELLTGERVEPTLGDWVTTPEALAATVESVMARVADA
GPAGIDIAAFDERERAAIDTVDDIVVDAGLVLPADAVDPYEDHPFLAELRAGRFAPPSAA
DIDRNDLREMTRRGHVVQNDGIVFHAATIDEAAEVAADLLAEHADGFTVAQFRDATGASR
KFALPLVAELDKRGVTRRRDDVRIAGPRLPSR
Download sequence
Identical sequences M5ASM2
gi|470180029|ref|YP_007566073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]