SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470180128|ref|YP_007566172.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470180128|ref|YP_007566172.1|
Domain Number 1 Region: 163-355
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.1e-64
Family Actin/HSP70 0.00000161
Further Details:      
 
Domain Number 2 Region: 357-513
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 3.79e-58
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000215
Further Details:      
 
Domain Number 3 Region: 2-160
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.11e-56
Family Actin/HSP70 0.00000457
Further Details:      
 
Domain Number 4 Region: 480-582
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 1.44e-20
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470180128|ref|YP_007566172.1|
Sequence length 618
Comment chaperone protein DnaK [Ilumatobacter coccineus YM16-304]
Sequence
MAKAVGIDLGTTNSVVSVLEGGDPVVIPNSEGARTTPSVVAFSKTGEVLVGEVAKRQAIT
NPDRTFRSVKRHIGENWKSEDVDGKQYTAQEISARTLMKLKRDAESYLGDTVTQAVITVP
AYFDDAQRTATKEAGTIAGLEVLRIINEPTAAALAYGLEKGSEDETILVFDLGGGTFDVS
VLEIGDGVFEVKSTHGDTELGGDDWDQRIISWLVDQFKAAHGVDLSADRMAAQRLQEAAE
KAKIELSQTQSTQINLPFITATADGPLHLDESLSRAKFQEMTADLIERCRVPFEQALKDA
GVAKGDLHHVILVGGSTRMPAVTDLVHDLTGKEPNKTVNPDEVVAIGAAIQAGVLRGDVK
DVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSEVFTTAEDNQPSVEIHVLQGERDM
SQYNKTLGKFQLVDLPPAPRGVPQIEVVFDIDANGIVHVSAKDRATDKTQSMTITGQSTL
DKDDIEQMVKDAEAHAEEDKKRREEAEVRNNADSLLYQTEKVLREQGDKVTAEEKEAVEQ
PLADLKTALEGNDNDAIKTATETLMSASQEFSQKLYEAAAKDSGAAGSSASGQDTADAGA
GSVDDDDIVDAEIVDDEN
Download sequence
Identical sequences M5A717
gi|470180128|ref|YP_007566172.1| WP_015443481.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]