SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470180183|ref|YP_007566227.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470180183|ref|YP_007566227.1|
Domain Number 1 Region: 60-565
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.31e-212
Family Heme-dependent catalases 0.00000000006
Further Details:      
 
Domain Number 2 Region: 594-738
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0000000000000458
Family Catalase, C-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470180183|ref|YP_007566227.1|
Sequence length 741
Comment catalase [Ilumatobacter coccineus YM16-304]
Sequence
MPSNTTKNAAKKNAAKKNAAKKSAAKKAPKKQSAAKKNAPNQTSKKQTAEQTAKNTTGPS
DRPSDSATHQTAGDGVATMTTQQGVAIADDQNSLTVGTRGPVSLEDFQLREKLFHFDHER
IPERVVHARGYGAKGYFESYDDQSQLTAAAPFSEAGKRTEVFVRFSTVAGSAGSPDLARD
TRGFAVKFYTDAGNWDLVGNNIPVFFIQDAMKFPDLVHSVKPEPDRGFPQAQSAHDNFWD
FVSLMPESMHHLMWVMSDRGIPRSFRMMEGFGVHTFRFVTASGESSYVKFHWKPKLGVQS
VVWNEAVKINGADPDFHRRDLWNAIEAGDYPEWELGVQVFDDAFADEFDFDILDATKLIP
EELVPVTPLGRMVLDQRVDNFFAETEQVAFCTQNVIPGIDFTNDPLLAGRNFSYLDTQLK
RLGSPNFTHLPVNAPRCPVAHFQQDGHMAMQSLSGRANYEPNSWGDDGGPRENPDTGYRS
FPAEEGGEKRKLRPESFADHYSQARMFYRSQTEIEQQHIADAIVFELSKVETHAIRTRIV
ASLLNVDNDLAQQVADGLGIDEMPDPLEPEATPIDVATSPALSMLADDLESFAGRRLGVL
VSNGADAKTLRMLRKAAEAEGMMVELVAATREGVSDSDGNSLQIAEKIDGGPSVLFDAVA
VVTTEEGASKLAAMPPARDFVSDAHAHGKFVAHVGAAAAIFDSAGVDTGAAGYTSLDGSR
KNADAFIESCRSVRAWDRSTD
Download sequence
Identical sequences M5A763
WP_015443536.1.75388 gi|470180183|ref|YP_007566227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]