SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470180408|ref|YP_007566452.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470180408|ref|YP_007566452.1|
Domain Number 1 Region: 646-753
Classification Level Classification E-value
Superfamily CalX-like 3.01e-24
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 2 Region: 68-220,274-460,579-643
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.82e-21
Family Virulence factor P.69 pertactin 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470180408|ref|YP_007566452.1|
Sequence length 932
Comment hypothetical protein YM304_42000 [Ilumatobacter coccineus YM16-304]
Sequence
MGTLHNHSDDPARTGIQRLRDGLTTSAALGATITVVAGAVLVNGQPVGADPVGGPTEVTS
LDDEINGDATTSLREALANAEGNAGPDTITFAPALFAGGPAVIEIGSTLRTFAHDVTITG
PGADQLTVRAVDESEEGEDVTAFYFYGDVAVSISNISIEATGSGIEAYGYYDGSMIESVT
LSGVDIEARREAVSISTVSGDVTITDSTLTNSEGGNGPIAAIYNAYGNVALTDVDITEAE
APIVGDGFAPFAEPRLGLIVERAASIDLTRVTTDTSYDGVLLRWVDGDVEVSDSEVTSDT
GGLAISYAGDVDLTDSTVTKLSDGMYVGRSFGPRRSAAVSIAGAGDIDIDTVSIDGGGVQ
AHYSSSLDITSSTISDSSTGAIHSVGVPLHLSDSTISNNVALYGTALIEAGGDGRRFPCL
DLCLDGAAADAPGLDGPGDYDSVTIINTTISDNDIHEDSTIIRSFERYSGDFLDSADEPY
TLSGVQLLHSTIAGNAVADEFPYGPPPLEEPAPAVVEASSVVIDHSIVTDNDGMTLIDPD
AGLRLADASGLGDAASLDGGLSPITASHSILPAAYGPVEGTNVFADDPGLGRLTDNGGPT
ETMLPDLDSPAVDAGAAGVVISIDQRGEDRPSGEASDIGSVERQASSISISADPATVAES
DGTVTLTVTRTGDGEGDASVRVSTADGTATAGDDYTALDQVVVLPAGQATTTVDLLIASD
DDVEPDETLTVTMSEADNVTIDVASVEVTITDSTTPTTTTPTTVPTSSTPTTTPSTTVPD
ATTTTTTTPLQINGDNPPPVAGGSESSFTVIIEQGDDEEVGVSAKSSNPGLLEVVSVQRS
GQGNAFTRGSAELTEVQYEVRVRAAAGGSGTATVTVTAVGESGTVTQDFEVVVSSQTLPA
TGSDTTQRTGLIGALLLGFGFVTSLFSRRRRA
Download sequence
Identical sequences M5A7V1
WP_015443761.1.75388 gi|470180408|ref|YP_007566452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]