SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470176919|ref|YP_007562963.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176919|ref|YP_007562963.1|
Domain Number 1 Region: 113-240
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000147
Family Phosphate binding protein-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470176919|ref|YP_007562963.1|
Sequence length 299
Comment hypothetical protein YM304_07110 [Ilumatobacter coccineus YM16-304]
Sequence
MSEQSIVAGPGGRDAVTDHGGGGLIAGLPMYDWPEVSSDIDALWTRIAREVTVRGLDAPI
GLTRTDHLETLWRDPRMIVGQVCSLNPVRDGLGETEVLGTLVYDPPLDLPQPEPGSYYSV
VVCRRDDSRRTHVGHGSATDDVLAFAGATFAANGTDSQSGYWSLGNFVREIADAPVFGPV
LFTGAHRASIQAVASGAADLAAIDVHSWRLALEHESHATDQLAVIGTTEPTPGVVCVVAW
ELAQHRALLDDALATAVDSLLGTPVAERLHISGYRARELEEFDVVADRVEAAARRSWHR
Download sequence
Identical sequences M5AHV2
gi|470176919|ref|YP_007562963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]