SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177549|ref|YP_007563593.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177549|ref|YP_007563593.1|
Domain Number 1 Region: 3-127,166-387,420-439
Classification Level Classification E-value
Superfamily Thiolase-like 1.21e-68
Family Thiolase-related 0.00081
Further Details:      
 
Domain Number 2 Region: 462-694
Classification Level Classification E-value
Superfamily Thiolase-like 1.2e-31
Family Thiolase-related 0.0091
Further Details:      
 
Domain Number 3 Region: 876-996,1088-1175
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.14e-27
Family FabD-like 0.0089
Further Details:      
 
Domain Number 4 Region: 1586-1727
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.14e-26
Family beta-Hydroxydecanol thiol ester dehydrase 0.0086
Further Details:      
 
Domain Number 5 Region: 1980-2130
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.21e-25
Family beta-Hydroxydecanol thiol ester dehydrase 0.0098
Further Details:      
 
Domain Number 6 Region: 1759-1937
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.86e-22
Family beta-Hydroxydecanol thiol ester dehydrase 0.027
Further Details:      
 
Domain Number 7 Region: 1364-1513
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 3.98e-20
Family beta-Hydroxydecanol thiol ester dehydrase 0.017
Further Details:      
 
Domain Number 8 Region: 675-758
Classification Level Classification E-value
Superfamily Thiolase-like 0.00000119
Family Thiolase-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470177549|ref|YP_007563593.1|
Sequence length 2399
Comment putative omega-3 polyunsaturated fatty acid synthase PfaBC [Ilumatobacter coccineus YM16-304]
Sequence
MSRFAPIAIVGRACVLPGALSPTALWDRVAAGDDLISRVPADRWKMDPADVMCDATGTDS
TDRTWSDRGGYVHDFDAVFDPTGFEIPADEIRSLDPVFQWTFHTAREALRDAGHDGLDPA
RFGAIFGNLSFPSAGMADFVEAVTLRDLGVASRDGAIDLAGARNRFTSGLPALLLERALG
LGRGAFALDAACASSLYAIKLACDRLHHGTADLMLAGAVNCADDLFIHEGFTALNALSRT
GRSRPFHPDADGLVPAEGCGFVTLRRLDDAVADGDTIHGIIRGVGLSNDGRGRGMLVPSS
DGQVRAMSEAFEVAGLDPTDVTLLECHATGTPIGDATELESSAQVYGECRDVPIGSLKSN
TGHLITAAGVAGVIKVIEAMRHQVRPPTLHVEQTIDALDRSPFRVLRDAEPWNRDDSPDG
VLRAGVSAFGFGGNNAHLVIEEPASAAALVGRVADEPRAACPIAIVGIGITAASAVGREA
FTDAIIDATSCLDDDGLGRMPDIELRLAAQKFPPNDLKAALAQQLAMLQVADEALDESGT
LPRDRTGVYVGMGTDPQAARFGIRWRVATLARKLGHDADWVAEARDAIGPALGAPGVLGT
MPNLVANRLNSQFDVAGPSFTVSAEEHSGLDALGLAVRSLRVGDIDAALVGAVDLSCDPA
HRAATDLIDDVSRPPGDAAVMLVVKRLDDAERDGNTIHAVICDDQVDTTGDLRLDAHVTD
LFGHAHAASGLVHVAAAAVALRHRTTVGGAPLLASNPESGSGLPDGAGPRTVSVETAAID
GIVPRSILLAEASDHRAPSRTAPPKLHVFSGTDAASVLAALDSGRASDVGPARLVIVADS
EEQFAERAERARRHIADGRPAGSGISYRSTPLDGEMAFVFTAGGAAYHGMGTQLLRALPE
LATPISTHFPLGDVSRWVHDPAHEPLPADYLWGTALLSQAHAQLTLGLLGLRPTAAIGYS
SGETNSLYAFGVWTDMDAMRREIVDTGMLDREIGVEFAAVARAWEVDHVDWAVWNILAPV
DDVRAAIADEPHVHLMLINTARDVVISGDAGLCRRLVEEFGTQRCRPVGYNLACHVPEVR
AAFHEPWLAVHTRQVTPAEGVRFYSNGVGGAYDVSTEACAEAITAQAENTVDFPATIRAA
YDDGVRVFVEHGPSSACSNFINEILDGHDVLAVHLDRRDSDIEQIFEVCAALVAAGIAVD
HEALTERLRPAEPSEVTHDGPVMSFPAHPEPARLPAPPAQQLQPMPPAPTLPSVFATVTP
PPTAEPTGAAATLLAQITAMTELHDAFVAQQAAMHERFLATRGNSLALLTHNGLRIAVDE
PPPPAAPPPPAVPTLPGPKWDKTQLQIHSSGRISELFGPMFEPQDQYAIQCRMPEPPLLL
ADRVTGLDAEPGVLGTGTIWTETDVERDAWYLNGGYMPAGFMIESGQADLLLISYMGIDL
LNQGERAYRLLGCTLVYHGDLPTAGDTLEYEIRITGHAKHGDIRLFFFEYDCIVDGARRL
TVRDAQAGFFTGQELRDAQGALWTPESGASALRADARVDPPVIDGTKRSFGRDEVRAFSE
GRVVDCFGPGFEWAHTHTRTPTIQAGDQLFIDEVTEFDPRGGPWGRGFMRCETTVADDAW
FFDGHFKNDPCMPGNFMVEACIEAMSFYLAATGHTARADGWRFQPLPEQPFELKCRGEIN
PQTEQMAYELYVEEIWDGPHPTIICDVLGFVDGKPAFHAHRIGVELVPGWPLTTMPEVAE
RPVAAPATEVVVATDAHGFPFDWKAMISCAWGKPSDAFGSMYADFDPTRRSPRLPGEPYH
FISRVTSIDGELDDCRAGMKIVCDYDIPDDAWYFDENGAEVMPYAVLLEAALQPCGWVAS
AVGSVTDSTDDMLFRNLDGTGTLVSELTRTSGTLTTRVELTSVSRAGGMIVEGFEVECSL
GDRVVYTMSTVFGFFPPAAFEDQVGLPITDAHRATLALADGSDSTTTDLTLRPERYCSGS
ARLAGDMLLMLDRATHLRGAGADGLGVVVGEKDVDVSEWFFKAHFFQDPVQPGSLGIEAL
LQLLQFFMLDTDMDAGLTDARFEPILLGAPMTWTYRGQVTPKNSAITTVMEITEVGVDDH
GPFVIGAGSLWCDGLRIYEVSNMGMRLVTDTLEIPLAITVDRERYPQLVDHAIDGTPVVP
VVLVLEWFTRLANAQASGLHLARLTDLRVLSGLVVDGYDTGGHLDLGASVRTSTETADGR
TLALELTDAATGRVHYRCNAELTPEPPRHAAFEPAAESEPGETWTGEIYGGEILFHGPAF
QVIENVSSVSATGLDAELSGLHEAGWPDEPWATDPALLDGALQLALLWTDRQLGGPSLPT
AIGSVRVFDAPGRGPYAATVTGRRATATMVACDISIRSATGSLVALLEGVETHKLPPTA
Download sequence
Identical sequences M5AK02
gi|470177549|ref|YP_007563593.1| WP_015440902.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]