SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470177843|ref|YP_007563887.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177843|ref|YP_007563887.1|
Domain Number 1 Region: 12-279
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.81e-41
Family Phosphate binding protein-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470177843|ref|YP_007563887.1|
Sequence length 288
Comment putative amino acid ABC transporter amino acid-binding protein [Ilumatobacter coccineus YM16-304]
Sequence
MRHSLTNKFLPAVAVGALVLAACGSDDDASSSDETSSGESDCGATVEDGVLTVATGEPAF
FPWVIDDDPSSGEGFEAAVAYAVAAEMGYEGDAVKWVRTTFDEAIQPGAKDFDINLQQYS
ITPERQENIDMSLPYFTSNQAIVALSGSAAEGATSIADLKDVKFGAQAGTTSLQFITDVI
EPSSEPFVYDDNVGAKAALEANQIDAAVFDLPTALYVSAVEIEGSSVIGQFPAEAGGTTD
EFGMVLAKDSALTGCVNDAITAITASGALADINAEWLADNTGAPVISE
Download sequence
Identical sequences M5A094
WP_015441196.1.75388 gi|470177843|ref|YP_007563887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]