SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470178831|ref|YP_007564875.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470178831|ref|YP_007564875.1|
Domain Number 1 Region: 15-130
Classification Level Classification E-value
Superfamily Nickel-containing superoxide dismutase, NiSOD 6.15e-43
Family Nickel-containing superoxide dismutase, NiSOD 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470178831|ref|YP_007564875.1|
Sequence length 140
Comment putative superoxide dismutase [Ni] [Ilumatobacter coccineus YM16-304]
Sequence
MFAKLFANATVAHAHCDLYCGVYDPAQAKIEALSAVKTAKKYAESDDEVFRARCISIKEE
VLEKTKHHLMVLWADFFAPPHFEEFPQLHELFWKATHQAGEAKKSMDPAVGEQLLAYIDE
IAEIFWKTEKAQAMGVYPPA
Download sequence
Identical sequences M5A2F7
gi|470178831|ref|YP_007564875.1| WP_015442184.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]