SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179275|ref|YP_007565319.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179275|ref|YP_007565319.1|
Domain Number 1 Region: 230-732
Classification Level Classification E-value
Superfamily SIS domain 6.12e-197
Family Phosphoglucose isomerase, PGI 0.000000000155
Further Details:      
 
Domain Number 2 Region: 8-216
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.31e-35
Family NagB-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470179275|ref|YP_007565319.1|
Sequence length 733
Comment 6-phosphogluconolactonase/glucose-6-phosphate isomerase [Ilumatobacter coccineus YM16-304]
Sequence
MDVVISDDPAHDAAAAIALRLRSAIDASGVASLAVSGGSTAPGLLAGLVDAIDTDRVSIF
QVDERVAPDGDADRNAEQLAALDLTAVLMPVTDGDLDAAAAAYATRLPERLDVVHLGLGD
DGHTASWPPAPHPDAGIVDDDGAVACVGEFNGRRRMTLLPEAVNGARLRVVLVTGAGKAD
VVRRWLIDGDSSLPISRVAGDDTIVFLDHAAASLLDGYGQATMTTLDDLSDLPRPAHLRE
LFADDPGRAERYTTTAADLRVDWSKNPIDDTVIASLLSLAETSGVAVRRDAMFAGEHVNV
FEDRAAAHVALRMPKGSTFMIDGVDVVPDVHEVLEKMAAFSDRVRADDTITHVVNIGIGG
SDLGPAMAYQALRPFRHERIRCSFVSNVDGADIDAVLADSDPASTLFIVASKTFGTIETL
TNARTARTWLVDALGEAAVADHFVAVSTNAERVADFGIDTANMFGFWDWVGGRYSVDSAI
GLSLMIAIGPDAFHDFLAGFHQIDEHFRTAPFAENVPVLMALLGVWWANGLGYDTKAVLP
YSNDLARFPAYLQQLDMESNGKSVDLDGRRVQHHTGPIIWGEPGTNGQHAFYQLLHQGTR
VVPCDFIGFVKAEHPYQEHHDLLMANLFAQSEALAFGRTNDAEPHRNFEGNRPNTVILAE
RLTPSVLGQLIALYEHIVHVQGTIWGVNSYDQWGVELGKELANQITPELVGEPSPDDHDS
STNALIAHYRSHR
Download sequence
Identical sequences M5A4R2
gi|470179275|ref|YP_007565319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]