SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470179571|ref|YP_007565615.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470179571|ref|YP_007565615.1|
Domain Number 1 Region: 1569-1833
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.31e-18
Family Complement components 0.024
Further Details:      
 
Weak hits

Sequence:  gi|470179571|ref|YP_007565615.1|
Domain Number - Region: 636-667
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00034
Family Pre-dockerin domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470179571|ref|YP_007565615.1|
Sequence length 2067
Comment hypothetical protein YM304_33630 [Ilumatobacter coccineus YM16-304]
Sequence
MEHGSRTKPNRMKRSIGVLAAGAMFAAACTGGGGSSSDTLPTGPSTTGPGGATNTPVGTT
TATGSSGATSTDDTSGRLGFRLSEGQSSAAEPAPIEPTDGTLLTSAEIDAVLDRLPEWDL
PDDDTQEFNRPVASLGPPLVGDTIATPFPPAPDEPTTPPDVASEPLDVLRFQPEGPVDVA
PFLSLTFNEPMVPLATLEQLDAVDVPVEMSPAVDGRWRWIGTRTLRFEVLPEADTSIDRL
PAATEFTVTVPAGTESANGAVLADAFSFSFSTPPADLEWVTGLSDSMPLEPVFVAQFDQR
VDSDAIVELIDFSAGDVIDVRLATDAEIEADDSARNVMAGALPNRSVAFVPVAPLAPDTA
VSISIGPGIPSLEGPLTSSAAYSDAGRTYAPLTVTDRNCGYGDCRPFSPFIIEFNNSLDP
ELFDPATVRVEPAVPGLRAEVSGSQLVVRGATSGNTTYTVSVAAELTDVFGQTLGELYTT
DFSVGPAQPFLTGPNRRFVTTDPFAPTPSLAYTSVNHDELYVTAWRVDPSQYRDFETYVD
SLYDRDAPRDPEWTPALTAVIDIDADPDEITETVVDLGDAFEVSDGPIVVRVETDPDLTP
DDDEYWQNQPIITWVQSTTLGVDAFVGSDELIVWTTDLLTGDPVPNAAVELVGTSRTTTT
DADGLARVDLDGQAISGLVATADGATGMLPAGWFDGWQASERGSESRWYVIDDRGVYRPG
ETVRVAGFVREIDAADAQLALVAGDQTVQYTVFDPQGNELVVDTADVNALGGFNLTFEVP
EESNTGYAYIDMRLAGAERYNTNHQFQIQDFRTPEFEVTARTESPAPYYVGEPATVAVDA
AYYAGGPLPNADVNWTVSTLETSFTPPNRGDFNFGIWTPWWYRSYDVYSDGGAYYEDDYY
FDECFDCFPTSDDRIREFSGTTNGNGSHFLQIDFEAADADGAPVDQPSSVTAEATVFDVN
RQAFSSRTNVLVHPASYYVGLRSERAFVRKGEPLEIDVIVADVDGAAIAGREVEVVAGRL
EYGYDGGRYTELLVDEQTCTVTSDASDEGVRCEFATELGGQYRITAVVADDAGRTNRAVF
TQWVSGSTAPPSRNLEQGEVTIVPDAETYAPGDTAELLVQAPFAPATGLVTVTRAGIEST
QVIDAPDGSAVVTVPIADDDIPNLQVQVDMVGSAERVGDDGTPLPDAPRRPAFAVGQIGL
QIPPVSRTLDVTATPASADVSPGSATTIDVAVVDAGGAPVAGAGVVVIAVDEAVLSLSDY
TLRDPISTFYQGVGTQLSPELVRRSIILANPDLLDAGIDQGVVDESEDGAMAEAPADEEA
MEESAGAPAAADTVGRAATDGAAAATPIDVRSNFDALAVFAPDETTGPDGTITVDVELPD
NVTRYRIMAVAVDGVDEFGSGESSLTARLPITVRPSAPRFLNFGDRFELPVVVQNQTDEA
VEVDIALEVANLDLDDATASSTDGDAATGKRVTISANDRVEVRFPTSAVEVGTARFRVAT
VSGDFADAAEIDLPVYTPATAEAFATYGVLDGDDAIAQPLLAPDGVFPQFGGLEITTSST
ALQALTDAVLYLYDYDYESADGYAARLMGVAALRDVLDAFDADGLPDVDTLNASVGRDIE
RLQALQNGDGGFPYWQRNRESVPWVSIMSAHALVLARDNGYTVDENVLSFALQHLADIES
YIPAVYGQETRDSISAYALYVRDLAGQRDSAKAIDLYRRSGGVDGTLQVDGLARLWPVLD
DTGARDEIEREIANRAVETPAAATFATSYGEDAYLIAHSDRRTDGIVLGALVSETPDNDL
IPKVVTGLLGNQNRGRWRNVYENVFILLSLNEYFGTFESVDPDFIARAWLGDTYAAETEF
RGRSTDSFLTEVPMAELVDAGDTDLVIDKDGAGRLYYRLGLRYAPDDLDLDPRDEGFVVE
RVYEAIDDPSDVVRNDDGSWTVKAGASVRVRLTMVADARRTHVALIDGMPAGFEAVNPAF
ATSVTVPLSDPSARSGYWWWQWYEHQNLRDDRAEAFTSYLPAGTFEYTYVARATTPGDFV
VPPTRAEEIYAPEVFGRSASDRVVIVD
Download sequence
Identical sequences M5A4L1
gi|470179571|ref|YP_007565615.1| WP_015442924.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]