SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470180238|ref|YP_007566282.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470180238|ref|YP_007566282.1|
Domain Number 1 Region: 218-357
Classification Level Classification E-value
Superfamily FAS1 domain 8.5e-40
Family FAS1 domain 0.00011
Further Details:      
 
Domain Number 2 Region: 375-514
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-39
Family FAS1 domain 0.00014
Further Details:      
 
Domain Number 3 Region: 46-185
Classification Level Classification E-value
Superfamily FAS1 domain 7.72e-39
Family FAS1 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470180238|ref|YP_007566282.1|
Sequence length 515
Comment hypothetical protein YM304_40300 [Ilumatobacter coccineus YM16-304]
Sequence
MKSRTKKILPALVAASMVAAACGSDSNDSVATDAPPATEAEEVAEGPGTIVDVAVEAGSF
TTLVAAVEAAGLVETLSGEGPFTVFAPTDEAFAALLSDLGITAEELLADTDLLTSVLTYH
VVPGAVLAETVVTLDGESVETVNGASVEISVDGDIVKVNDANVTATDIEASNGVIHVLDA
VLLPPADDAMEEDAMEDDAMEEDAMEEDAMEEDAMADEPGTIVDVAVEAGSFTTLVAAVQ
AAGLVETLSSEGPFTVFAPTDDAFAALLSDLGLTAQELLADTELLTSVLTYHVVPGEVLA
ETVVTLDGESVETVNGASVEISVDGDVVMVNDATVTAVDVDASNGVIHVIDSVLLPPADD
AMEEDAMEEDAMADEPGTIVDVAVEAGSFTTLVAAVQAAGLVETLSSEGPFTVFAPTDDA
FAALLSDLGLTAEELLADTELLTSVLTYHVVPGEVLAETVVTLDGESVETVNGASVEISV
DGDVVMVNDATVTAVDVDASNGVIHVIDTVLIPSS
Download sequence
Identical sequences M5A7B8
WP_015443591.1.75388 gi|470180238|ref|YP_007566282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]